If no accession number is given or only a partial protein sequence is found in the database then the protein sequence was derived from genomic sequence. Grey shading indicates genomes that are complete according to ncbi




Yüklə 371.95 Kb.
səhifə8/10
tarix23.04.2016
ölçüsü371.95 Kb.
1   2   3   4   5   6   7   8   9   10

> Sclerotinia sclerotiorum (PQRB) NCBI:XP_001594998

MVCAASSLTVESYEDVTTSTMASGTEDTKPLNRRRHSSFHPKRTASEQLMDGEEGLMLKVDIFLSELERRLDFIEKYGNLTFDSSISWSYATLQAVRMRCSQVSGEVIGATKRRARIMVETVESRYQDALAAHETLHEKVHTGIGLLEGILSEFEARAYKVKEKGLRGTAESLMDEGRKIVDEGLGKAREVVDEGFERAKKAAGTVEEHIENAIARAKKHGLIRYEDLPVPWRVNPHIVEGYRFTESKVECIQSMFGLSNETVNIWSHAIGLLIVLSIAFYFYPSSHAFSLSTKADVVIAACFFFAACKCLVCSTMWHTMNSVADQTLLERFACVDYTGISLLIAASIMTADYTAFYCEPVSRWLYMGVTAALGVGGVILPWHPTFNRQDMAWARVAFYVCLGATGFVPALQLNLTRGGAWAAEFYAPLAKSITVYLLGAFVYASQVPERWCPGAFDYIGGSHNLWHFAVLGGILFHYVAMQEFFANAFARAENGC*


> Sclerotinia sclerotiorum (PQRA3B) NCBI Genome

QTTHDRLTQYRPASNSFLKSLHSLSHVHNETVNIYSHLFGSLLFATLPFILYRQIAPRYATATLADIIVFSTFFFGVAICFLLSATYHILANHSPKINALGNQLDYLGVVILMWGSTIPTVYYGFYCSPTLQNLTQNQISILATFCAIITLHPKFRNPALRPYRAVMYSCLGLSSVIFIVHGVFLFYEVQRYRMSLDWMGVMAGLNLLGAFTYAVRVPEKWFPRRHDIVGSSHQVLHFMVIFAGLAHMAGLLRAFDHIHSEEFRCT*


> Sclerotinia sclerotiorum (PQRA4) NCBI Genome

MDTSKIEDITISNLPRSESDKPPELPLYRQVSTQPSNTGLITYDDLPSWHKDNPSIYTSYRPITHSISRSLKSLFTLHNETLNIHTHSLPFLTCFLLIGLIFYIFSIYFPHSPLVDKFIFAIFFLTTTICMGLSTGYHTLMNHSQEVAGIWLRLDFCGIVVAILGDFVTGIYVAFYCEWKLQVGYWVMVCDPFLCFYVLLLHPHFQGLQWRTFRVCMFIGTACSAFAPIINGIVYFGWHEVVKGTGMPWYLGEGGLLVLGAVIYAVRIPECYFPGKFDIIGHSHQIFHLLVVGAAGLHLAGLLKAYNYEYHHPRCGLR*


Dikarya; Ascomycota; Taphrinomycotina; Schizosaccharomycetes; Schizosaccharomycetales; Schizosaccharomycetaceae; Schizosaccharomyces; Schizosaccharomyces pombe
> Schizosaccharomyces pombe (PQRA) NCBI:NP_596013

MSESEQLLEKQQDHKWDAATHADKGITIKTGKIAVSSSDIPLRNRKGLLTWDQLEPWQQDNQYIISGYRPPSFSFYLCVKSIFHVHNESVNIWTHLFGAIVFLFFIFKSELILKRDTTTAEDVYVITVFLFSAFTMLGCSTFYHTISNHSDDVSKFGNKLDYLGIVVMIVGSFIPCLHYAFACHANFRTLYIGTIIGIGVIVASTCLLDRFRQPEWRPYRALIFVLMGLFGIFPVIHALKIFSFSEILVRMGLVWLLLQGLFYIVGAVIYALRIPEKWSPGKYDVFGSSHQWFHVCVIIAAFCHFHGVCIAYDYFHERRGCGEM*
> Schizosaccharomyces pombe (PQRB) NCBI:NP_593206

MSTVKTFSSTETEGFKKRLLSRRHSSYQVRDEEDDVLEEFIVLKLDLFLTRLNHRMKRLEELGLPNRKDAAAATYQFLANLQASFLGTTILGKTQVSFILRRIEETYNDVLSACDTFPAKAQKALTFLEHHLRDLEDYAEKSKNNVETLMTDIKDVVEHAAKLGAQRLITLEELPVQWHNNPYIIRGYRFYTSKRKCFRSILSWHNETFNIWTHLSAFIVFFAVLAYFYPSSSSWVSSNVSNRIVRIFFLLSAMKCLGCSVIWHTFSSLSNYKHMRCAACMDYVGISALIAASIISVEYHAFVCQGPLRFIFIAFTGTLGLIGIYTPWKKWFNEYKYRSVKIFFFVGLACSGLIPMITMFYIKGTRRTVKYLDPVFKSIFSYIIGVLFYGLHIPERFLPGKFDIIGNSHQIWHIAIIVGVAFHYTGVKRFETDYEAFSCGVL*
Dikarya; Ascomycota; Taphrinomycotina; Schizosaccharomycetes; Schizosaccharomycetales; Schizosaccharomycetaceae; Schizosaccharomyces; Schizosaccharomyces japonicus
> Schizosaccharomyces japonicus (PQRA) NCBI:XP_002174036

MKKTESTTVYETIPQNEKTVQESGNDFQTTSKQSSKVKLRRHKGYPLLKWNEIQPWQQDNQYIVRAYRPASNSFLRSIQSIGHIHNETVNIWTHLLGALYFLYMIHGVRNLLSRDTTTAEDRYVVLVFIVSAFTMLAMSTAYHTLCNHSPRVAKFGNKLDYLGIVVMIVGSFVPSIHYGFACHASFQVLYTATIFSIGVIAVFACCLERFRKPQWRVYRAGIFTAMGLFGILPVAHAATLYPLGQLLSSMGLGYLILQGVLYIIGAVLYAMRFPEKTKPGIFDVLGSSHQWFHLFVLTASLCHFRGIYVAYAYFHDHPSCLA*


> Schizosaccharomyces japonicus (PQRB) NCBI:XP_002173299

MSTTRTLSVPVNTATETRGKNDAKIRRNSYVVGRGRDDEVLEDFVMAELSSFLTRLGERLQEIRSNGASFQEGSMKTVIEFFVRVHEYVSSDTGVIGTKQVASMLQLVEEKYHDILDACDTFPKKAQAALTFMERRLADLERSSARSLQNVDSMLSDATEMFSCAIKMGTRRLLTIDEVPVDWQNNPYILRGYRFYQSKRRCVKSILSWHNETVNIWSHMLGMFVFAGICLFLHPNTQWWTDLPLSNRLIALVFLLAAVKCLACSTIWHTFASLANLKAMHRAACMDYLGISVLIAASIMSVEFYGFSCFPKMRNVFLFFTGSLGVIGIYTPWKDWFNDNKYRHVKIAFFVGLACSGFAPLLTMIHMRGFYYTMWILRYVMYSIACYCFGVTLYAFNFPERAFPGVFDNLGNSHQWWHFMIVCGVSFQYCALKHFERGENFVCNL*


Dikarya; Ascomycota; Taphrinomycotina; Schizosaccharomycetes; Schizosaccharomycetales; Schizosaccharomycetaceae; Schizosaccharomyces; Schizosaccharomyces octosporus
> Schizosaccharomyces octosporus (PQRA) NCBI Genome

MNNLKDRGNNCSGAKLKEKFDSNDPSVIQTGEVRIEKSAVPSKNTKSLLTWDELEPWQQDNHYIISAYRPASFSYFGSLKSILYLHNESINIWSHLFGVIIFLFFIIRSERILVRETTTSQDVYVFMVFLISALTMLFCSTFYHTISNHSSHVSKYGNKLDYLGIVIMIVGSFVPCLHYGFACHANFRTLYTGTIFSIGVIVAFTCMLDRFRQPEWRSFRAILFVIMGLFGIFPVLHALFIYTIKDLLVRMGLGWLFLQGVFYIVGATIYANRIPEKWYPGKYDVFGSSHQWFHVCVVIAALCHFQGILIAYNYFHEAAQC*


> Schizosaccharomyces octosporus (PQRB) NCBI Genome

MFLSRLGDRMKRIEEVGLPTIEEPNTTYEILVRLRNSFIGSTILGKNQVMYFLRMIEEKYHDVLAACDSFPSKALKALNVLESLLSDLEDIANVESRTTVGEIFEDTKEKLQSAIRAGESRLLKVEEVPLEWKNNPFIVRGYRFYPSKRRCIRSMLALHNETFNIWTHLIAFLGFLMVTSYFYPLSTSWISSSVSNRIVRVFFLVCAMKCLACSVTWHTFSSLSKYEHMRRAACMDYVGISALIAASIIAVEFHAFKCHSMFRVLYIAVTGSLGCIGIYMPWKEWFNDYNYRSFKIFFFVGLACSGFLPLLTMCYIQGTSSTLIYLKPVFMSIFSYIIGVIFYALHIPEKLNPGIFDIVGNSHQLWHIAIIIGIGFHYYGIKTFETTHRGFACDCV*


Dikarya; Ascomycota; Taphrinomycotina; Schizosaccharomycetes; Schizosaccharomycetales; Schizosaccharomycetaceae; Schizosaccharomyces; Schizosaccharomyces cryophilus
> Schizosaccharomyces cryophilus (PQRA) NCBI Genome

MCNSKVRRSNSAISHLKEKCELDDPNVVQTNEVRIEKSAIPFQNSKLLFWDEIEPWQQDNHYIISAYRPATFSFTKSFKTILYLHNESINIWSHLFGAIMFLFFITRSERILVRETTTSQDVYVFMVFFISALTMLLCSSFYHTISNHSSHVSKYGNKLDYLGIVIMIVGSFVPCLHYGFACHASFRTLYIGTIFSIGVVVAFTCMLDRFRQPEWRSFRAILFVIMGLFGIFPVLHALFLYTINDLLMRMGLGWLLLQGVFYIVGATIYAKRIPEKWYPGKYDIFGSSHQWFHVCVIIAALCHFRGIFVAYDFFHEAAKC*


> Schizosaccharomyces cryophilus (PQRB) NCBI Genome

MAQPQLCESERAEGLRKRVHGRRHSSYEVENKKGDIPEDVVVYKFDLFLTRLGDRMKRIEEVGLPKIEEPNTTYEILVRLRNSFIGSTILGKNQVMYFLRMIEEKYHDALAAYDSFPSKVLEALNFLETLLSDLEDIASVESRTTVGEIFEDTKEKLQRAIRAGERRLLELDEIPLEWKNNPFILRGYRFYSSKRRCIRSVLAFHNETFNIWTHLIAFIGFFTVISYFYPSSTSWISSSFSNRIVRIFFLVSAMKCLACSVTWHTFSSLSKYEHMRRAACMDYVGISALIAASIISVEYHAFKCHTLFRVLYIAITGTLGCIGIYMPWKKWFNDYRFRSFKIFFFIGLACSGFLPLLTMCYIRGAVETFSYLKPVFLSIFSYIIGVLFYALHVPEKLYPGVFDIVGNSHQLWHIAIIIGIGFHYYGIKTFETYHQGFACDLV*


Dikarya; Basidiomycota; Agaricomycotina; Tremellomycetes; Tremellales; Tremellaceae; Tremella; Tremella mesenterica
> Tremella mesenterica (PQRA) JGI Genome

MPLTRRSARVSSSGAKQDPLVAEESSSDLTFSTSSLLLTYDQSLRLVPWQTDNDYVLTGYRRQQRTIQDCLRSSVAYLHNETVNIHSHSLGAAFFAILLPLHLHPTHFPHFSFSDRATPVPPTLHDKVALTLYLSCAMTCLGLSSWFHTVQCHSKATCDAAHRGDYRIGIVTLIVGSILPGMYYAFHDSLFFQTYVIAAISAAGIASAYIVLSPHHRAHRWHRTLTFIALGLSAVIPVGHVVATKGISYSRQVLSLDLLVAGGVSYIFGAVLYAARFPEQLAPGRFDYFGHSHQIFHLFVLAGAGCQYAALRGMVWGRAMAVGHQFS*


> Tremella mesenterica (PQRB) JGI Genome

MPTAEEASDPTARPARTSWARRLSHPTLPTFPHNIPNLRAALLGYISEVEDAIRERLSSVSAPDQPVDSSGTSSKLQVISDTSSDDENMGSSSISDQTFVTSPNTSPRRNANTPPPETLEPTNDLTLLRQLNTLREDVLAYLPNRLPAWSLNQDWLASLPSRLRVVDAVVSVPGGNTEGVKGKNKEEGNEGNGALDAARGKVLELVQSFLPAEDWAGWHRLGWSEGGYPPPSSPFHDDAMEDEEDEPEYLFPNRTPASAQAVARRRIVRSKSLGASSVGWRNDLPILTRSKTTPNVLTNDSDETDLTLSPATEAIGVEPEDMKRISDMGMGPTVAEALEKADDGRRLIGYEDLPFVWRNNEHIITGYRFIPMHANTGPIPLIKSAFGWHNETVNIQSHFVPTIILLLLIPIMVIHSPLPDAHWLDTAILAMYFLAAVACLSSSASWHVLSGSASRGWFEWGACVDYIGISWLISASFFTVVYNGFYCHPTAVFTWGSINLFCGALGSYLPFQKWFNERKHKDWRISFFLFLCFAMFAPMVQMFYQHGWTRGLHFVSPFGLSVTAYVVGLLFYGFHFPECILPGKFDYIGASHQIWHCAIILAILLHYRAVLVAHSVRYAYSCASPAVGRSVGEVVERWCGILMESLKGLIW*


Dikarya; Basidiomycota; Agaricomycotina; Tremellomycetes; Tremellales; Tremellaceae; Filobasidiella; Filobasidiella/Cryptococcus neoformans species complex; Cryptococcus; Cryptococcus bacillusporus
> Cryptococcus bacillusporus (PQRA) NCBI Genome

MPETTPLLPKSGETSQDGERRTISYEESLTLLPWQTDNDYIRDYIRHGYRRATPSIRKCLWSAVSCKHNETVNIHSHSIGAAFFLSLLPLHLIPTHFPTFGQSCNPLPTPPTLHDKVALSLYLICSVSCLSLSSWFHTVSCHSREVCDAAHRGDYIGIVILIVGSITPGMYYAFYENLFLQVFYMGGIIIAGITSAYIVLSPHHRSHRWHRTLTFIALGLSAVVPITHILFTQGLAHAREKMSLDLIVAGGASYIFGALLSAARIPEKLSPGTFDYFGSSHQIFHCFVLMGAAFQYAALRGMVWGRTMAVGKTIAESEGLL*


> Cryptococcus bacillusporus (PQRB) NCBI Genome

MEMIEDEEPEYLFPNRTPASTRALARRRAVRSKSVGASSLPSVKRAKMERSQSYAFGSLVGSTQGKAVSEPVKMGTAVRSDHEDGDEGRDENAGEEYEVTEEEGKDEEEFISTSYLAADLKSGLIAVGTTTDPSVADALKRSEDGKKLITYDELPAIWRNNEHIHTGYRFIPLHLKTGPVPLIKSAFAMHNETVNIHSHLIPTLFIFACIPFIIYNTPLPDAHPLDTAVVVAYLVAAISCLSSSAGWHVLSGCASRKWFEWGACVDVTGLIAASFGTVVYNGFYCKPKLTLFYCTTNMLCGALGSYLPFQRWFNERRNKQHLRISFFLFLCFAMFAPMVHMFGQYGWHKASAFVAPFMVSVAAYVVGLLFYAFHFPECKWPGKFDTWGSSHQIWHLGIVVAIVLHYRAIFVAHNVKHEYSCAVPGQEISVAMVLERMIGWR*


Dikarya; Basidiomycota; Agaricomycotina; Tremellomycetes; Tremellales; Tremellaceae; Filobasidiella; Filobasidiella/Cryptococcus neoformans species complex; Filobasidiella; Filobasidiella neoformans (aka Cryptococcus neoformans)
> Cryptococcus neoformans (PQRA) NCBI:XP_772556

MPETTPLLPKPGETCEDGERKTISYEESLMLLPWQTDNDYIRHGYRRATPSIRKCLWSAVSYLHNETVNIHSHSVGAVFFLSLLPLHLIPTHFPTLNQSCSPLPTPPTLHDKVALALYLICAVLCLSLSSWFHTVSCHSKEVCDAAHRGDYIGIVVLIVGSITPGMYYAFYENAFLQVFYMAGIIIAGIVSAYIVLSPHHRSHRWHRTLTFIVLGLSAVVPITHILFTQGLVHAREKMSLDLIVAGGASYIFGALLYAARIPEKLSPGTFDYFGSSHQIFHCFVLAGAGFQYAALRGMVWGRAMAVGKTIAESEGLL*
> Cryptococcus neoformans (PQRB) NCBI:partial XP_772530.1

MEMIEDEEPEYLFPNRTPASTRALARRRAVRSKSVGASSLPSVKRAKMERSQSYAFGSLVGSTQGKAVSEPVKMGTAVRSDHEDGDEGRDENAGEEYEVTEEEGKDEEEFISTSYLAADLKSGLIAVGTTTDPSVADALKRSEDGKKLITYDELPAIWRNNEHIHTGYRFIPLHLKTGPVPLIKSAFAMHNETVNIHSHLIPTLFIFACIPFIIYNTPLPDAHPLDTAVVIAYLVAAISCLSSSAGWHVLSGCASRKWFEWGACVDYIGISWLIAASFGTVVYNGFYCQPKLTLFYCTTNMLCGALGSYLPFQRWFNERRNKHLRISFFLFLCFAMFAPMVHMFGQYGWHKASAFVAPFMVSIVAYVVGLLFYAFHFPECKWPGKFDIWGSSHQLWHLGIVVAIVLHYRAIFVAHGVKHEYSCAAPGQDISVAMVLERMIGWR*
Dikarya; Basidiomycota; Agaricomycotina; Tremellomycetes; Tremellales; Tremellaceae; Filobasidiella; Filobasidiella/Cryptococcus neoformans species complex; Filobasidiella; Cryptococcus gattii
> Cryptococcus gattii (PQRA) NCBI Genome

MPETTPLLPKSGETSHDGERRTISYEESLTLLPWQTDNDYIRHGYRRATPSIRKCLWSAVMTININIYFPAVNIHSHSIGAVFFLSLLPLHLIPTHFPTFGQSCNPLPTPPTLHDKVALSLYLICAVSCLSLSSWFHTVSCHSKEVCDAAHRGDYIGIVILIVGSITPGMYYAFYENIFLQVFYMGGIIIAGITSAYIVLSPHHRSHRWHRTLTFIALGLSAVVPITHILFTQGLAHAREKMSLDLIVAGGASYIFGALLYAARIPEKLSPGTFDYFGSSHQIFHCFVLMGAAFQYAALRGMVWGRTMAVGKTIAESDGLS
> Cryptococcus gattii (PQRB) NCBI Genome

MGSEHPQGTQEPQDQSPWRRRMSQPLSIPTFRPNIPNIPHLRAALLGYLGELETALRRKLGDDLSEIGGALHGGGNGRGRTRWRSVSLSPSMSAEDWTTSTESNDEDSYHGYSSALAGPSSTSEVRQRNATTNASSNGSPNVNTKAHKDATTDASSTQDSYVNLLNHLSALREEASNYLPSLSAHMPLSIPNREWLRSLPSRLSIVDPGLLSPLDKAKIKDELAAVIDFESGAVEGARKRVVDMVHALLPSEDWAGWEKLGWEEQEDGDGWRPREYGHRRARSASLGRSGKGKRKQDNDSDYSEMEMIEDEEPEYLFPNRTPASTRALARRRAVRSKSVGAASLPSVKRAKMERSQSYAFGSLVDSTQGKAVSEPVKMGIGVRSDREDGDEGRDEDGDVEYEVTEEVGKDEEEFISTPYLAADLKSGLIAVGTTTDPSVADALRRSEDGKKLITYDELPAIWRNNEHIRTGYRFIPLHLKTGPVPLIKSAFAMHNETVNIHSHLIPTLFIFACIPFIIYNTPLPEAHPLDTAVVVAYLVAAISCLSSSAGWHVLSGCASRKWFEWGACVDYIGISWLIAASFGTVVYNGFYCKPKLTLFYCTTNMLCGALGSYLPFQRWFNERRNKHLRISFFLFLCFAMFAPMVHMFGQYGWHKASAFVAPFMVSVAAYVVGLLFYAFHFPECKWPGKFDTWGSSHQIWHLGIVVAIVLHYRAIFVAHNVKHEYSCAVPGQEISVAMVLERMIGWR*
Dikarya; Basidiomycota; Agaricomycotina; Agaricomycetes; Gloeophyllales; Gloeophyllaceae; Gloeophyllum; Gleophyllum trabeum
> Gleophyllum trabeum (PQRA) NCBI Genome

MLRPQKVTAREARDAAQAHRRNQTPESRTVTWRAIEPWQRDNDYILAGYRRAQRSFRGCLASVFGYLHNETVNIHSHLWGALLFAYLLCTYPRTYLAAHATTTWADYVVAAIFLSSAVFCLASSAGMHTFSCHSEPVCARCHALDYTGIVVLIVGSFFPCVYYGFYCDPFWRALYLTVILVSGLGAAYIVLNPEYARPSHRGARTKVFIALGLSAVLPVTHALASHGFAKLLREMGFGWLVLSGALYIAGALLYANRIPERFEPGRFDYFFASHQIFHVCVVLAALAHYTCVLTAFEHWHSRGGQCV*


> Gleophyllum trabeum (PQRB) NCBI Genome

LSSTVIPELMEKGKTRIDETEDAVGRAAREIKDAIKRSFDGSKLIQYADLPHQWRNNEFVRGGYRFIPLERWPLIILSLFMLHNETLNIHTHLIPFLVWLPSLLRSLPHLLLSSASTLAHTSSLSNHPTMDAPELAFTAFALFCLFCSAVWHTMSGCAHARGMELCARVDYVGIGWLISASVGTVVYYGFRAHPACSTFFLAFSFVMGVVGSVLPFQAWFNEPAYKNYRIAFF


Dikarya; Basidiomycota; Agaricomycotina; Agaricomycetes; Agaricomycetes incertae sedis; Polyporales; Coriolaceae; Postia; Postia placenta
> Postia placenta (PQRA) JGI Genome

MGPDSPGIPTDRLTLTWLEIPAWQRDNEFILTGYRRCAPTYQSHAWSAPLNVARAVNIQTHLFGAVLFGVLLSTFHQVYLARFDSTTWADYAVFTIFLSAAVFCLLTSSFYHTFSVHSREVALRCNAVDYAGIIVLTVGSTFPCIYYEFFCDTLLQTTYLAVMVLVGTGAAYIVLDPEYCKPTHRGARTTVFIVLGLSGIVPITHGLLTHGFAKLLTEMGFGWLVVAGALYICGALLYANRVPERFAPGAFDRLGASHQIFHVCVVLAALATYACVLTAFGHWHGRRGVCPA*


> Postia placenta (PQRB) NCBI:XP_002476048

MATLTETITLRHRRTPGARRFSTNQAGTYVARSLCQSLPHSLEALDLSGSTISPALAEVCSHLPELTLDSVRSHMSEVSPLEGMRAHLSDMPDAVRSRLPELDLWDMRARLDDMCSRISDLGLTRPLHYIQSLSDNLQSLRAHLSSLELPQSLNLAALSPNASSAFNDLYDKVVSSELYAEISSDIREGEKAALEITRAVKQSVNGSRLILYVDLPQQWRNNPFVKHGYRFIPLQEWPRLILSLFALHNETLNIHTHLIPFFAWLLTIFPSSAGQSDMPLLTFTAFALLCLFTSALWHTMAGCAHPTGMELCARIDYVGIGWLISASIGTVVHYGYQCNPMACKFFLSLCFIMGLSGSILPFTDWFNRYEYRRYRIAFFVALALTSIAPLAHLAKLHSAMQMFSFMRPIVPSLVSYVAGLVFYATHFPECYLSSRWAHSHLLDRFGGGSHAIWHVFIVIAISQHKAAMSELKRGIGEACW*


Dikarya; Basidiomycota; Agaricomycotina; Agaricomycetes; Agaricomycetes incertae sedis; Polyporales; Coriolaceae; Gelatoporia; Ceriporiopsis; Ceriporiopsis subvermispora B
> Ceriporiopsis subvermispora B (PQRA) JGI Genome

MNLSTDPPANFHDKVLPWMYLKEWQRDNEYILRGYRRVTTRVNIHSHLFGAILFLYLLFTFQQTYFRQYESIIYMDYAVFAIFLCSAVFCLFSSTFFHTFLAHSKEVSALCNAVDYAGILVLIVGSFFPCIYYAFYCEPHLQTLYLLLIVHAGAGAAYIVLDPEYRKPTHRGARTKVFIALGLSAVIPVSHGLITHGYRKLLHEMGFGWLLLSAFLYISGAVLSAMRIPERLYPGKFDYFLASHQIFHIHVVLAALAHYACVLTAFDHWHGKIGTC


> Ceriporiopsis subvermispora B (PQRB) JGI Genome

MASWTQTSTELRRRQTAASRRLSIIVGAASDGCSPLPHSLEALDLPYTSLAPTLASLRHHVLSYLADIETTLAELDSPISSDKLKATGESTVEEARAWAQEGLEMLRSIRQEVYAHLPEIHLDNVSSVEDFVKSHFLEIPLPDVRARLPEMPDAVRSRLPDVRSRLGDMRTRISELGSHRPLRYIPTLTERLHSLQTHLSSVDIPHALSNTTLSPNATVAALLDRVRSSALVSEISSEIRHGEDKLEEAALEIARAVKRSLYGSQLIQYVDLPEKWRNNPFVTGGYRFIPLDQWPRLILSLFALHNETLNIHTHLIPFLTLAFTLLPLSSILPSVLVFVQPVQDTPVLAFTAFAMLCLFSSSLWHTMAGCAHPQGMDLCARVDYVGIGWLIAASVGTIVYYGFQCDSIASKIFLGFCFAMGVSGSILPFTNWFNEKEYRTYRISFFVALAMTAIAPLAYLAYLHSASAMLQFIRPVVPSLLSYILGLSFYATHFPECYIAHRWPNARWLDWLGGGSHAIWHVCIVCAIVQHRAAMAVLKHGIEGVCV*


Dikarya; Basidiomycota; Agaricomycotina; Agaricomycetes; Agaricomycetes incertae sedis; Polyporales; Coriolaceae; Fomitopsis
> Fomitopsis pinicola (PQRA) JGI Genome

TLTWNEIPAWQRDNEYILSGYRRAQYSWRGCAHSVFGYLHNETVNIQTHLLGALLFVGLLGTFYHTSLAPYETAAWQDLVVFMIVLSAAVFCLLASSWYHTFSVHSEQVAIRCHAFDYAGIVVLTVGSFFPCIYYEFYCDTHLQILYLSLIVLVGLGAAYIVLDPEYSQPTHRGARTKVFIALGLSAIFPVVHGLLTHGLRKLLYEMGFGWLVASGALYISGALLYANRIPERLSPGKFDYFFASHQIFHVCVVLAALSHYMCVLTAFEHWHAQAEPHCSL*


> Fomitopsis pinicola (PQRB) JGI Genome

MTVDEARAWARDGLALLRSIRNDVYSHLPDLTFDNVRTHMPDVPGLDEMYARMPDMPDVRSHLPDLDLSDLHARLDDIRARVSDIDFHRPFDYVNTLNDRLQSLQTHLSSIEIPHRLDLSLLSTTSALSEMYDKVASSPFVAELSSDLREGERIACEVACAVKQSLNGSRLIQYADLPQQWRNNPFVKHGYRFIPLSEWPRLLLSLFALHNETLNIHTHLIPFVAWLVALFPFSPLSSTVPEPDAPMLAFTAFALLCLFTSALWHTMAGCAHPKGMELCARIDYVGIGWLISASVGTIVHYGFQCDSWAHDGFLSLCLVMGIAGSILPFMDWFNEYEYRNYRIAFFLTLAFSSVAPLATLAYVHTAPAMFAFIRPVVPSLLSYVAGLVFYATHFPECYLASRWAHSHVLDRVGGGSHAIWHVFIVLAISLHKAAMAHLKGGIGGELCY*


Dikarya; Basidiomycota; Agaricomycotina; Agaricomycetes; Agaricomycetes incertae sedis; Polyporales; Coriolaceae; Trametes
> Trametes versicolor (PQRA) JGI Genome

MPGKPPRQRKTRQDDLTNDIQDPNAHSSLYVKDATHTSTLGKTRSKTLTWLEIPEWQRDNEYILTGYRRATASWRACAASVFGYLHNETVNIHSHLAGAVIFAVLLVSFPTVYFAHYESTTWEDMAVFMIFLCAAIFCLFSSAFYHTFSAHSEAVAGRCNGLDYAGIVVLTVGSFYPCIYYGFFCDRHYKTFYLSGITIAGLGAAYIVLNPEYRKPTHRGARTKVFIFLGLSGVIPTLHGLVTHGYYTLCYEMGFGWLLASGAMYIVGALLYANRIPERLSPGTFDYFLASHQIFHFFVLAAALAHYAGVLTAFDHWHRRVSGCPAR*


> Trametes versicolor (PQRB) JGI Genome

MATTTTTAATATATTSATTSAVRAHPTDAHVRRPARRRLSTFHAGRYALPHPCHQLPPSVEALDLSLTSLTPTLASLRLHVLTYLADLETRLSLLESPISSESIKAKGELTMDEARAWAQDGLEMLRTIREDVCAHLPDFTLDNVPSMEDFVKTHMPDVPTLPDMTDMRSHLPDMPDVVRSHFPDFDLSDVRSRIDDVRTRFSDIDFPRPLDYVPTLSNSLQSLQAHLSSMDLTQSLYISTYAPSASLSTLLDRVLSSHFVSEISSDLKSGEETLEKAALEITRAMKRSLNGSRLIQYVDLPEKWRNNPFVKGGYRFIPLHEWPRIVLSLFALHNETLNIHTHLIPFLLWTFALFRLSPFFSALEADEPAEVIFTAFALVCLFTSALWHTMAGCAHPHGMELCARVDYVGIGWLISASVGTVVYYGFQCHELTRNAFLLLCLGIGLSGSILPFTSWFNKREYRHWRIAFFVSLALSGIAPLAELSRAHGPRAMGAFISPIVPSFVAYLVGLAFYATHFPECVLAPRWPRARVLDWLGGGSHAIWHVCIVAAISLHRSGMEQMQRGIEAACAVVV*


Dikarya; Basidiomycota; Agaricomycotina; Agaricomycetes; Agaricomycetes incertae sedis; Polyporales; Coriolaceae; Wolfporia; Wolfporia cocos
> Wolfporia cocos (PQRA) JGI Genome

MSKSVDGELSLRARHDKELDTADPRAAPPASAPVAHDRKTLTWLEIPAWQRDNEYILTGYRRIQYSWRGCAHSVFGYLHNESVNIQTHLFGAVLFAGLLATFGRAHLAPYASVSWADYAVFAVFLAAAVFCLLASAFYHTFTVHSREVSLRCNAVDYAGIVVLTVGSFFPCIYYEFYCSPRLQTAYLLLIVLVGAGAAYVVLDPAYATPSHRGARTRVFVALGTSAVVPVAHGLAAHGPRTLWTEMGFGWLFASGALYIAGAVLYANRVPERFSPGTFDRFGASHQVFHVCVVLAALAHYVCVLTAFGHWHRGGARCVA*


> Wolfporia cocos (PQRB) JGI Genome

MNSVADTNELRRRRAPNARRFSTTQTSRSLCQSLPHSLEALDLSHAALTPAIASMRLHLLDLLTDLETRLSVFEYPVSPELLKSRGGSTMDDARVRAKDVLAMLRSIRNDVLSHFPDFSVRSHMPDVDGMRAHLPEARVPNAVRSRLPDLDLSEMRARLDDARARLSDVPQHYINTLADHLQSLQAHLSALELPHSLSLSSLGPYGKVLSDGEDRIEKAAMQVARAIQQSLNGSRLIHYVDLPDQWRNNPFVKHGYRFIPLQEWPRLILSLFALHNETLNIHTHLIPFLAWLLTLFPFSPISSAAVYADPPVLAFTAFALVCLFTSALWHTMAGCAHQRGMELCARIDYVGIGWLISASVGTVVHYGYQCNPTTRSVFLTLCLIMGISGSVLPFTEWFNRYEYRKYRITFFVALAFTSVAPLAHLSYLHSTAQMFAFIRPVVPSLVSYTAGLTFYATHFPECYFSSRWAHWHMLDRFGGGSHAIWHVFIVLAISQHKAAMAVLKGGVGEACW*


Dikarya; Basidiomycota; Agaricomycotina; Agaricomycetes; Agaricomycetes incertae sedis; Polyporales; Phanerochaetaceae; Phlebiopsis; Phlebiopsis gigantea
> Phlebiopsis gigantea (PQRA) JGI Genome

MSVNLRRRTETSGPAEANVGDRTLEDFQSRIHSDPNDRFDAPPKRYSRTDSPTVTWNEIPPWQQDNEYVLTGYRRIQYSWRGCAVSVFGYLHNETVNIHSHLFGGVIFCWFLATFRQAYLVKYETASWVDTAVFAIFLASAITCLFCSASYHTFGVHSKGVAERCNALDYAGIVILTVGSFFPCIYYEFYCEKNFQMLYLSVMSLAGIVAAYIVLNPEYRKPTHRGARTKVFIALGLCGVVPVTQGLLTHGFSKLCYEMGFAWLIASALLYISGALLYANRIPERFAPGSFDYFFASHQIFHVHVLLAALAHLKCILTAFTYWHGEDPLCTA*


> Phlebiopsis gigantea (PQRA6) JGI Genome

MPPPRLRQRPTTDAVPLLKPETLDQQHARNRTICFDELPAWRQDNPAVVTGYREGVENWQACLSTIWWWHNETVNIWTHLLGGLASMSLAVYIIYKAIADHNPDLAQTVSWSTPFTGVLTSVNWQDGVAFGVFFFGCIVCFFCSTVFHTSLCHREDVVRWTSRMDFLGILTLGTFNFFPTFHYGFYCDPVFRTIYPSLMAVSGFGIYLVCAPTYSSPSYRRMRAVTFVSLGLVAVFPFAHAMVRYGLHEARQNMALGWIAIEIIAYLTGVLLYAERCPECIFPGRFDLVGASHQLFHICSLLAVTFHYIATVKAFQYRHIVHAGTCTA*


> Phlebiopsis gigantea (PQRB) JGI Genome

RRTRRRVSTSHAGKQRGRLQCKPLPSSVDALDLSLSSPLPVLASIRLQVLSYLADLESRLTLLESPISSDSLKSPTVEEARIWATTTLEMLNQIRADVCSHLPETPSVEDFLKSHIPDVPCLDDVCAHLPAVPDAVRTRLTDITIADISSRLDDVRASFPDLHFRRPLEYIPTLSEHLQSLQSHLSSVDLPQSFCDSIAYFRPHASLSELLEKVLSSDLVAGMSSDIRGGEDMLEKAAVEVARAVRRSLNGSQLIHYMDLPEKWRNNRFVARGYRFIPLQRWPLIIMSLFALHNETVNIHTHLIPFLLWSLNFVPLSLVPSSSPVRPDTPELAFTAFALLCLFTSALWHTMAGCAHPKGMELCARVDYVGIGWLISASVGTVVYYGFQGHETARNAFLLLCLVMGVLGSVFPFMEWFNDIKYRNYRISFFLALAFSSLAPLAHLAYLFSTSEMLSFMQPVVPSLLAYIAGLVFYATHFPECMLARPGEKHWLDWLGGGSHAIWHVCIVCAISLHRSAMEPMRKGI


Dikarya; Basidiomycota; Agaricomycotina; Agaricomycetes; Agaricomycetes incertae sedis; Polyporales; Polyporaceae; Dichomitus; Dichomitus squalens
> Dichomitus squalens (PQRA) JGI Genome

MHKFKDTMRARTGVLTNSPVPVNSIEDPNFADGRGPTAIAVTEAGGGEQSDSSEARTKRQVGGHDPRKTLTWLEIPEWQRDNEYILTGYRRATGSWRACAASVFGYLHNETVNIHSHLGGAVLFAVFLFTFPSVFLVHYESTSWADRAVFVIFLSAAVFCLFSSAFYHTFSAHSQGVAARCNALDYAGIVVLTVGSFFPSIYYSFYCEPHLQTFYLTCICAVGLGAAYIVLNPEYRQPTHRGARTKVFIFLGLSGVVPTLHGLVTHGFYTLCYEMGAAWLLLSAACYIGGALLYANRIPERFSPGTFDYFLSSHQIFHFFVLAAALAHYASILTAYDHWHRRLGGCPAHVQY*


> Dichomitus squalens (PQRB) JGI Genome

MATATAVEEHSPDARLRRPAQAPRRRLSTFQAGRYALPQPCHQLPYSVEALDLSLNSLPPTLASLRLHVLSYLADLESRLSLLESPISTEAIMAKGELTMEEARTWAKDGLEMLRSIREDVLSHLPDIFSLDSVPTVEDVEEFVNAHLPEVPTLPEMRSHLPDVPDVVRSHLPDFKLSDVRSRLDDVRSRISDLDFNKPLNYVPTLSNRLQSLQEHLSAMERSSSLYLSTLAPSATLCTLLDKVLSSHFVADISSDLRSGEETLEKAALEIGRAMKRSLNGSRLIQYVDLPEQWRNNPFVKGGYRFIPLHDWPRLVLSLFALHNETLNIHTHLIPFLLWSFALFRFSPSYDTSDYQEPAKIAFTVFALLCLFTSALWHTMAGCAHPEGMEFCARVDYVGIGWLISASVGTLVYYGFQCRPAERDVFLLLCLAVGLSGSIVPFTQWFNQREYKNARIAFFLCMAFSSIAPLVELSRLHSPWEMYTFISPIVPSLVSYVVGLVFYATHFPECVVAPRWPSLCRWLDWLGGGSHAIWHVFIVLAISLHKRGMEVMKGGIGDACTV*


Dikarya; Basidiomycota; Agaricomycotina; Agaricomycetes; Agaricomycetes incertae sedis; Polyporales; Ganodermataceae; Ganoderma; Ganoderma sp. 10597 SS1
> Ganoderma sp. 10597 SS1 (PQRA) JGI Genome

MREDTLHVRPTAAVHTNTPVNANGVDAKSPNAIIDGDPTTVTVAVTLVDGGKARKASKTLTWLEIPDWQRDNEYILTGYRRATASWRACAASVFGYLHNETVNIHSHLGGAVLFVALLFTFPSVYFVHYESTTWADMAVFSIFLCAAIFCLFSSAFYHTFSAHSPGVAARCNALDYTGIVVLTVGSFFPCIYYGFFCDPHLQTFYLTCICVAGIGAAYIVLNPEYRKPTHRGARTKVFILLGLCGVGPTLHGLVTHGFYTLCVEMGFAWLLVSAVCYITGALLYANRIPERFSPGTFDYFFASHQIFHCFVVAAALAHYASVLTAFGHWHRRLGECPASA*


> Ganoderma sp. 10597 SS1 (PQRB) JGI Genome

MATLTTSAVEEHSSDARLRRPAHPSRRRRSTFQAGRYALPQPCHHLPHSVEALDLSLTSLPPTLATLRLHVLSYLADLETRLSLFESPISTDAIMAKGELTMEEAAAWARDGLEMLRSIREDVVSHLPDIFSLDGVPSVEDVEQFVNTHMPDVTLPEMRSHLPDMPDVVLSHLPDFNLSDVRSRLDDVRSRISDLDFNRPLNYVPTLSNRLQSLQAHLSTMELPSSMYLSSFAPSATLSALLDKVLSSHLVADISSDLQRGEESLEQAALEIARAMKRSLNGSRLIQYVDLPQKWRNNRFVGGGYRFIPLHDWPRLILSMFALHNETLNIHTHLIPFLLWSFAFFRFSPSYDASGLQEPVKATFTAFALLCLFSSALWHTMSGCAHPKGMEFCARVDYVGIGWLISASVGTVVYYGFQCRPVERDAFLLLCFLVGVSGSIVPFTNWFNQREYKNARIAFFLSLAASSVAPLVHLARLHSAEAMYGFIAPIVPSLASYVVGLAFYATHFPECVLARRGGARWLDYVGGGSHAIWHVFIVLAIRLHRDGMEDMRAGVIGETCLVALESFGSVPASA*


Dikarya; Basidiomycota; Agaricomycotina; Agaricomycetes; Agaricomycetes incertae sedis; Hymenochaetales; Hymenochaetaceae; Fomitiporia; Fomitiporia mediterranea
> Fomitiporia mediterranea (PQRA) JGI Genome

MDLRHRNISQKLSHVIEEVKTAEHEAIELVKTLTWHQLEEWQKDNEYIIRGYRRAQNNWKGCFHSIFGYLHNETVNIHSHLFGAILFLILFFTNQLYVVARYPTATWVDSTMFSIYILSAVFCLTSSSFYHMAGCHSESVASRCHAFDYSGIITLIVGSFYPGVYYGFFCHPAIRAFYLGSFLLAGLGAAYIVLNPEYAKPTHRGARTTVFIALGLSSAVPVIHALFIYSLHTIQVEMGFQYMVLSGVLYIIGALLYANRIPERLSPGTFDYFFSSHQIFHVMVVLAALTHYNAILTNIEYWHGQRAGVCLA*


> Fomitiporia mediterranea (PQRB) JGI Genome

MSNTTVSEVVHVQTEAHVLHRRVEVTKHRQSTQQRPRSASTSCNPLSSSLTTSSLSMASHAPVLASVRVLVLSHLAELERRLVSITLSLEDSENETLDNSGEQLVTGETHSWAHDTLEMLRRIRSDVSSHLPDLPFDVPALEELLHTHFHDLSYQVLLDDIRAHLPDLPRPHMPDFTLSDVQTKLHDVRAHLYEMSLDMSQPMSYLPVLSQHLNSLQAHLAAVSARSDYVLPSLPPTSTLSELLDRVLSSDMVPAVLHRVDGHDSPFERVAREYSEALKKSYNGARLVSYVDLPKEWRNNPWVDSGYRFIPLHKWPIILLSLFALHNETLNIHTHMIPLLHTALHFIPSLNYASVPLDRPEKFYTGFAMLCLLLSVVWHTMSGCAHRVGMELCARVDYVGIGWLISASVGTVVYYGFSCHSEIVMAYLSLCLVTGILGSVFPFMAWFNDRKYKPVRVVFFLGMAFTALAPMAHLTYMYSFSSMVSFIRPIAPSFLSYIIGLVFYVTHVPERFVYSKGIAHWTDWLGGGSHAIWHAFIVLAIYQHRWGMVEMRAGVDGEGCVV*


Dikarya; Basidiomycota; Agaricomycotina; Agaricomycetes; Agaricomycetes incertae sedis; Corticiales; Punctulariaceae; Punctularia; Punctularia strigosozonata
> Punctularia strigozonata (PQRA1A) JGI Genome

MSELRRRNRDHSLGLEDIGADAASPPTNSVNGISAEGLVGAIQDLSERVSHTLTWHELEEWQKDNEYITAGYRRARNSLRECLRSVYAYLHNETVNIHSHLWGAVLFVLILFTFNSNHISRYELSAGWLDLGVFTVFLSSAVFCLSASAFYHMVGSHSDDFSTRCRAFDYTGIIVLTVGSFWPAMYYAFFCAPHLRTFYLTVITACGLGAAFFVLNPEYGKPTHRGARTKASVFIGLGLSGVVPSAHALAIHGAHDLWHNLGFSYLIASGALYIFGALLYANRIPERFAPGRFDYFFASHQLFHLCVVLAALAHYGGVLKAFDYWHGRNTLQPCLSS*


> Punctularia strigozonata (PQRA1B) JGI Genome

GSVLFLYFLTIFRDIHLADCQARNSVASTSVPVAVVAFLCSASACFVLSSLYHVFECHSIHLLDYTGIIGLIVASSYPWNYYYWFCEPRYQLFYLSSVTVVGVGAAAAIASPRYSRPEHASARVLLFTSLMVINVTALVHAAIRDGFQKLCETMGVRYILCSWAFYLLGGVLYAKRFPESKAPGRFDIFGASHPLLHICVIIGAVLHYVTVLRIFHHWHPAVGLANGT*


> Punctularia strigozonata (PQRB) JGI Genome

MPTTSSTTTTTTTAVEATRTVPMRRNRRRLSSYRSNPQRQMLCHTLPKSLDALDLSSSGVPRPTLASLRVHVLAYLADLETRLSLLESPQFSPASLGLGSGFDSYIESAESKVHEKVEEVRQWARAGLESIAKIRSDVCSYLPDFPDLEESMVNVKSRLPGVSPLGSLSLEEMRSRLPELPSVEDVRSRLPEIPQLPDIQLPELSMPQMPELEFDLSTLRPRLESLSSHIDSLQTHLSSAALYLPHLPHVYSLNMSIAPSTMLSDLLDKVLMSDHLYKMLPKEDEKEESMLEKAAREVAAAVKSSMHGAKLIRYSDLPNKWRNNPFVTRGYRFIPLDQWHRIIISLGQIHNETLNIHTHFLPFVFWLLPLLPFTPTIASQLPSSIASLLPSSLHSASMVPTTAADLDLPELIFVIFALLCLFASAVWHTMAGCAHPRGMEICARLDYVGIGWLISASVASVMYYAFQAHPAARDIYLGLSFFTAIAGTVLPFMDWFNQRQYKKYRIMFFLALGFTALAPLTHLSLLFSPYRTLVFIAPVLRSVSSYLAGLVFYATHFPECMLSKHPRWRWLDWLGGGSHAIWHAFIVLAIAQHRAAIAGLKSGI*


Dikarya; Basidiomycota; Agaricomycotina; Agaricomycetes; Agaricomycetes incertae sedis; Corticiales; Corticiaceae; Phanerochaete; Phanerochaete chrysosporium
> Phanerochaete chrysosporium (PQRA) JGI Genome

MRQRKPSSVEEDVSSKILHVLEDFQSHIHADPSDKSDAPPERDPSKITGLTLTWHEIPAWQKDNEYILTGYRRWPSTFVLLLTSMFYLHNETVNIHSHLFGGLLFCWLLLTHYQSYHSQYDTTTWSDAVVFAIFLASAILCLFCSASYHTFGVHSRGVAERCNALDYAGIVILTVGSFFPCIYYGFYCKRHFQVLYLTLISGAGIIAAYIVLNPEYRKPTHRGARTKVFIGLGLCGVVPVTQGLITHGFTKLCYEMGFGWLLTSAGLYISGALLYANRIPERFAPGRFDYFFASHQIFHVHVLLAALAHRRCVLTAFNYWHSMDPLCAAQT*

1   2   3   4   5   6   7   8   9   10


Verilənlər bazası müəlliflik hüququ ilə müdafiə olunur ©azrefs.org 2016
rəhbərliyinə müraciət

    Ana səhifə