If no accession number is given or only a partial protein sequence is found in the database then the protein sequence was derived from genomic sequence. Grey shading indicates genomes that are complete according to ncbi




Yüklə 371.95 Kb.
səhifə7/10
tarix23.04.2016
ölçüsü371.95 Kb.
1   2   3   4   5   6   7   8   9   10

> Gibberella zeae (PQRB) NCBI:XP_381240

MSDVTTAITTACTYKARDSDNIATTSGSDIRPDAGPRKRRHSFFIPRRRSIVGHIMDGEEGLLLKVDLFLSELERRLDFIENYVDLSKDSSISRTFSTLQAVRSRCSHASEEVLGAGRRRLHIMVDTLETRYKETLEAAESLNEKAHMGVDLLETMLSDFETRAYKLREQGFANAANAAEAFMDEGRRVANEGIERAIQAAYSLEEHIQQAIVLAKEGRLISYDDLPSPWRNNPHIHKGYRFTESKLECIRSVFTPSNELFNIWSHALGLVLVLAIALYFYPNTVNFTLSSKSDVFVAGVFFVMACLTLVCSTIWHTMNAVADVDAISIFACVDYTGISLLIAASIMTTEYTAFYCDPVSRYIYMGLTAFLGIGGVILPWHPRFNGADMAWVRVAFYVGLALTGFLPMVQLGWTHGLDFVYDFYSPISKSMLVYLSGAFVYASKIPERWYPGCFDYIGGSHNLWHAAVLGGILFHYSAMQAFFANAFHRAEGGCPSY*
Dikarya; Ascomycota; Saccharomyceta; Pezizomycotina; Leotiomyceta; Sordariomyceta; Sordariomycetes; Hypocreomycetidae; Hypocreales; Clavicipitaceae; mitosporic Clavicipitaceae; Metarhizium; Metarhizium anisopliae
> Metarhizium anisopliae (PQRA1) NCBI Genome

MSNLRRRRPSTTESILTTLQALEKKAESKLLLLWDDLPPWRRDNAFIHSGYRQIRASYAHSFQSLFYLHNESVNIWTHLLGALAAIISSVYVYYVVHPRYEAATSSDVLVFSCFFGGAILCLGMSATFHALVDHSEAVAKWGNKLDYTGIVALIVGSYVPALYYGFFCSPALMSGYLYLICTLGIGCAVVSWVERFRTPKWRIYRASMFIGLGLSGVVPVVHGMSVYGYAGLEERMSISWVIAQGAMYIFGAVLYAARWPERSFPGSFDIWGSSHQIFHVFVLLAAATHFYGMAKAFDAHHGNGPTCVW


> Metarhizium anisopliae (PQRB) NCBI Genome

MSDVTTAITSACGYKPRDDEQLRTCAVKASGSEVQNTDPPASQRRRHSFFLPRRKSIVETIMEGEEGLLLKVDLFLSELERRLDFIESYYDDLGRDYSFSRAFATLQAVRTRCSQASEEVIGAGRRRLQIMVETLEMRYQETLTAAESMHEKARVGVDLLEEMLSEFEARAHKLREQGLAGATTAAEAFMDEGRRVAHESIERARGVMDEGLERARRAALSLEEHIQQAVAKARETRLLHYNDLPMPWRNNPHITKGYRFTETKIECVQSAFNISNEFINIWSHAIGLVLVLAVALYFYPASANFSLSSKSDVFVAAVFFVMACLTLVCSTIWHTMNAVADVDAISIFACVDYTGISLLIAASIMTTEYTAFYCDPLSRWVYMTLTAVLGIGGVILPWHPKFNGTDMAWARVAFFVGLALTGFMPMLQLSLTHGPDFVVTFYSPILKSILVYFVGAIVYASKIPERWWPGMFDYVGGSHNLWHAAVLGGILFHYTAMQTFFSNAFHRAEGGCPAY


> Metarhizium anisopliae (PQRA2) NCBI Genome

MSGAELKKRLVPNGNMSTTNDSTTQSKAKARTVTWQEIPEWQLDNKYILSGYRPEKADYWEIFTSLTFLHNETCNVYTHLVGALLLPLVATAFLRYLAQPQFLHVLSMDYAMFGIYFWCAEACLILSTLYHLIQPHSHHVELFWHGMDLLGIVIVTVGTFSSGIYYVFFCEAVLQELHWAIILTTGTVTGVLISNPSLRTPRWRKVKVGAFVVFGASSFIPLLHGVQRYGLEYMLQYSGMKWYLLELTFYGTGVSLYAFRIPERLAPGKFDIWGSSHQIFHVAILCAMYTHVTALLQGFTTCHTLDVCQLQGVHRAD


Dikarya; Ascomycota; Saccharomyceta; Pezizomycotina; Leotiomyceta; Sordariomyceta; Sordariomycetes; Hypocreomycetidae; Hypocreales; Clavicipitaceae; mitosporic Clavicipitaceae; Metarhizium; Metarhizium acridum
> Metarhizium acridum (PQRA1) NCBI Genome

MSNLRRRRPSTTESILTTLQTLEKKAESKLLLLWDDLPPWRRDNAFIHSGYRQIRASYAHSFQSLFYLHNESVNIWTHLLGALAAAVSSVYVYCVLHPRYEAATSSDVLVFSCFFGGAILCLGMSATFHALVDHSEAVAKWGNKLDYTGIVALIVGSYVPALYYGFFCSPALMSAYLYLICTLGIGCAVVSWVERFRTPKWRVYRASMFVGLGLSGVVPVIHGMSVYGYAGLEERMSISWVIAQGAMYIFGAVLYAVRWPERSFPGSFDIWGSSHQIFHVFVLLAAATHFYGMAKAFDAHHGNEPTCGLE


> Metarhizium acridum (PQRB) NCBI Genome

MSDVTTAITSACGYKPRDDEQLGTCAVRASGSEMQNTDNPANQRRRHSFFLPRRKSIVETIMEGEEGLLLKVDLFLSELERRLDFIESYYGDLGRDYSFSRAFATLQAVRTRCSQASEEVIGAGRRRLQIMVETLEMRYQETLTAAESMHEKARVGVDLLEEMLSEFEARAYKLREQGLAGATTAAEAFMDEGRRVAHESIERARGVMDEGLERARRAALSLEEHIQQAIAKARETRLLHYNDLPIPWRNNPHITKGYRFTETKIECVQSAFNISNEFINIWSHAIGLVLVLAVALYFYPASANFSLSSKSDVFVAAVFFVMACLTLVCSTIWHTMNAVADVDAISIFACVDYTGISLLIAASIMTTEYTAFYCDPLSRWVYMSLTAVLGIGGVILPWHPKFNGTDMAWARVAFFIGLALTGFMPMLQLSLTHGPDFVVTFYSPILKSILVYFVGAIVYASKIPERWWPGMFDYVGGSHN

LWHAAVLGGILFHYTAMQTFFSNAFHRAEGGCPAY
> Metarhizium acridum (PQRA4A) NCBI Genome

MLRNRVIVTDNAPSTAPIRLPTKQLSSAAKDNIPPSKSVLLTISQIPEWYSENPYIHTGYRPVFAAIAPCIGSWCYLHNQSFNIYTHLIPGIFALVVNAGLCQYFSVWYPEATALDRLVFHVYLTAVSVCFGVSAAYHTLLCHSREFADLWVRLDYVSISVLILGSFVPGLYMGFYCEMGLLGAYLGMIFSMGLLNVYLSINDRYGAKNWLTSRLLPFLGMGFSAFIPIVHAAVIFPYDQ

LQKQSGLHYYLLEGVFMLVGVLFLATKFPECWLPGTFDYIGASHQIFHCFVVMEGLGAKMRGYRDGGLH
Dikarya; Ascomycota; Saccharomyceta; Pezizomycotina; Leotiomyceta; Sordariomyceta; Sordariomycetes; Hypocreomycetidae; Hypocreales; Clavicipitaceae; Epichloe; Epichloe festucae
> Epichloe festucae (PQRA1) NCBI Genome

ELLLWDDLPAWRRDNAFIQSGYRQIRASYKHSFQSLFYLHNESVNIWSHLLGALVAIACAAYLYYVIHPRYEQATSSDVFVFSCFFTGAILCLGMSATFHTLVDHSRDVAKWGNKLDYTGIVALIVGSYVPAMYYGFFCKPALMSTYLICILGGGCGIVSWVERFRTPQWRPYRAGMFIGLGLSGVVPVIHGVSIYGYSGLEDRMSISWVIAQGTMYIFGAVLYAARWPERSFPGSFDIWGSSHQIFHMFVLLAAATHFYGMAKAFDSHHVLG


> Epichloe festucae (PQRB) NCBI Genome

RARRAAVSLEEHIQQAVAKARETRLIQYHELPTPWRNNPHIKRGYRFTETKIECVQSAFNMSNEFINIWSHVIGLFLVLAVAFYFYPASTNFSLSSKSDVFVAAVFFVMACLTLVCSTIWHTMNAVADVDAISIFACVDYTGISLLIAASIMTTEYTAFYCDPVSRWIYMCLTASLGFGGVILPWHPRFNGPDMAWVRVAFFVGLALTGFMPMLQLSLTHGPDFVITFYFPILKSILVYFGGAIVYASKIPERWWPGMFDYIGGSHNLWHAAVLGGILFHYTAMQTFFSNAFHRAEG


> Epichloe festucae (PQRA2) NCBI Genome

QEISEWQLDNKYILSGYRPEKADYLDIFTSLTFLHNETCNVYTYLVGALLLPLVATVFLRYLGKPQFLNVSSMDYSMFGIYFWCAEICLVLSMLYHLMQPHSHHVEQFWHGMDLLGIVIVTVGTFSSGIYHVFFCEASLQKLHWAIVSLSGTGTVTGVLISNPSLRTLRWRKVKVGALVVFGASSFIPLLHGVQRYGFEYMLQYSGMKWYLLELAFYGTGVGLYAVRIPERLAPGKFDIWGSSHQIFHVAILCAMYTHVTALLQNFTTCHTLDVCQL


Dikarya; Ascomycota; Saccharomyceta; Pezizomycotina; Leotiomyceta; Sordariomyceta; Sordariomycetes; Hypocreomycetidae; Hypocreales; Hypocreaceae; mitosporic Hypocreaceae; Trichoderma; Trichoderma atroviride
> Trichoderma atroviride (PQRA1A) JGI Genome

MLLGTVYTSLLRTVKHAEQKVEQKLLLLWDDLPAWRRDNAFILSGYRPIRPSYAESARSLFYLHNEFVNIWSHLAGAIVAIITATWLYLVIHPRYETANSSDVLVFACFFGSAVVCLGMSATYHALTDHSQEIARWGNKLDYTGIVALIVGSYVPTLYYGFFCHPILMTGYLYLICILGIGCVAVSWVDKFRTPAWRPYRAMMFISLGLSGIIPICHGFLKFGYQSLEDRMSLSWVVMQGLMYIFGAVLYAARWPERVYPGAFDIWGSSHQIFHMFVLFAAATHFYGMTKAFDHHHAGMGSQCL*


> Trichoderma atroviride (PQRA1B) JGI Genome

MRRSRPAPPEVALRQRHPLGTGLFTEAINVAKVTENKAEKALLLWGDLPAWRRDNAFIHSGYCQIRPSYLHSLRSLFNLHNESVNVWSHLLGAIAAVASSFYLYCVIRPRYDSITPSDVLVFAFFIGGAVLCLGMSATFHAVLNHSQKVARWGNKLDYTGIVVLIVGSFVPALYYGFFCMPMLFAAYLCLICLLGTGCAIVSWVEQFRTPKWRPYRAMMFTSLGLSGFIPVIHGVTIYGYKGFEDRTSVTWIIVHGAMYIFGAALYVARWPERSFPGAFDIWGSSHQIFHMFVLLAAATHFYGMVKAFDYHHTILGSSCLTE*


> Trichoderma atroviride (PQRB) JGI Genome

MAGVTTALTSACGFNHDGDDKDSTGVAATSGSDLRREAQQQAKRRRHSFFIPRRKSIVGHIMEGEENLLLKVDLFLTELERRLDFVENYVDLSKDSSISRAFSTLQTVRSRCSQASEEVIGAGRRRLYIMLETLDTRYQETMAATESLHEKAGLGIELLEGMMAEFETRAYKLREQGFANAATAAEAFMDEGRRVANESIERAKSVVDEGIERAVRAALSLEEHIQQAVLLARDRGLLLYDDLPTPWRNNPHIKRGYRFRETKIECVRSVFNMSNEFINIWSHALGLILVLAVAFYFYPSSANFYLSTKTDVVVAAIFFMMACLTLVCSTIWHTMSAVADVNAVSMFACVDYTGISLLIAASIMTTEYTAFYCDPVSRWVYMGLTAFLGIGGVILPWHPKFNGTDMAWARVGFFVGLALTGFMPILQLYFSHGPDFVYNFYSPISKSLLVYFSGAVVYASKVPERWFPGMFDYIGGSHNLWHAAVLGGIIFHYTAMQQFFSNAFHRAEAGCPAY*


> Trichoderma atroviride (PQRA4A) JGI Genome

MALYRRLSPTGVGGIDPDADSDNEDRRSQAPKTTRRLQTSAEIPPWYGHNSFIRTGYRPITGSVKLCFESLGYVHNETANIYTHLVPAVIAVVGNYGLYVYFSSHYPNASWRDQLVFHIYLSTSVICFGISSMYHMLLCHSEAYASLWARFDYATIVVQILGSFISGIYIGFYCEPHLQKLYWTMIGSLGLLTGIVVVNPKFQSPKWRTLRVSTFVATGLSAFAPIIHAATIFPYAQLDKQAGLRYYYLEGVAMLTGVFFYITHFPESRKPEKYDIWGASHQIFHSFVVLGAVIHFYGILNAFDWNYNNPRCV*


> Trichoderma atroviride (PQRA2A) JGI Genome

MSTTNEPMDHMQPKASKTQTVTWQEIAEWQFDNKYILRGYRPEKADYLAVFTSLTFLHNETCNVYTHLIGALLLPLISPIFLRFLADPRFFNVSSMDYAMFNVYFWCAETCLVLSALYHLMQPHSHSVEQFWHGMDLLGIVIVTVGTFSSGIYYVFFCEASLQKLHWSIILTTGTITGVLISHPLLKTSRWRNVKAGAFVVFGSSSFIPLLHGVQRYGLTYMLQYSGMKWYLLELTFYGTGVTLYAFRIPERLSPGTFDIWGSSHQIFHIAILCAMYTHVTALLQGFTTCHTLDVCSLQGVH*


> Trichoderma atroviride (PQRA4B) JGI Genome

MSPTSPRVLSSTPSADKGRKVLLSFDQLPRWHQDNEFILHGYRPISGSARLSFRSWSYIHNESVNIYSHLIPAVVFLLGEWYIIQYLTSRYSHITGVDIFIISFFLLTAVICLGLSTTYHTLMNHSSEVEQLWLRFDLVGIVVLTLGDFVSGIYMVFWCEPLERKIYWSMIGVLGSLTIFIMVNPYFQGKKFRVFRALAFVGTGLSGFAPLIHGVTMFGWSQMMKQSGMPYYLAEAGFLLSGALIYVTKFPESRFPGKFDIYGSSHQLFHIFVVFATVAQLIGILVAFDYNYANRTCSSH*


> Trichoderma atroviride (PQRA2B) JGI Genome

MVKSQTVTWHEISEWQRDNRYILSGYRPERGDYLEILTSLTFLHNETCNVYTHLIGALLLPLIAFAVMQILSQPQFFDVSSSDYVIFGIFFCCAECCLIFSTIYHLVGSHSHAVEQFWLRMDLLGIVIVTVGTFIPGIYYIFICEPVLQKLHWAIITSSGTVTAALISMPRLRTLRWRKARTGAYIALGASAFIPLLHGVQLYGLEYMLQYAGMKWYLLELFFYGCGVGLYGSRTPERFAPGKFDIWGSSHQLFHVCILCAMYIHITALVQAFTACHTLDVCSIQAASREGHR*


Dikarya; Ascomycota; Saccharomyceta; Pezizomycotina; Leotiomyceta; Sordariomyceta; Sordariomycetes; Hypocreomycetidae; Hypocreales; mitosporic Hypocreales; Fusarium; Fusarium oxysporum
> Fusarium oxysporum (PQRA1) NCBI Genome

MADTQPYGVRNRRPSVTDNLINAAKNFESKFEQSLLILWDDLPAWRRDNAFILSGYRQSHGSYAHSFRSLFYLHNESVNIWSHLLGAIVFLASAAYVDRVVRPRYESASSADVLVFACFFGGAVVCLGMSATYHTLSNHSDTVSKWGNKLDYTGIVALIVGSYVPALYYGFFCLPNLMVFYLWVVSLICILGLGCTIVSWVERFRTPAWRPYRAMMFIGLGLSGVVPVIHGLFIYGYQGLEDRMSLSWVLLHGVMYIFGAVLYAARWPERSAPGAFDIWGSSHQIFHIFVILAAVTHFYGMAKAFDYHHTIMGSQCLMD*


> Fusarium oxysporum (PQRB) NCBI Genome

MSDVTTAITTACAYKARDGDNIASTSGSDIRPDVEPRRRRHSFFIPRRRSIVGHIMDGEEGLLLKVDLFLSELERRLDFIENYVDLSKDSSISRTFSTLQAVRSRCSHASEEVLGAGRRRLHIMVDTLEARYKETLEAAESLNEKAHVGVDLLENMLSDFETRAYKLREQGFANAANAAEAFMDEGRRVANEGIERAIQAALSLEEHIQQAIVLAKEGRLLSYDDLPSPWRNNPHIHKGYRFTESKLECVRSAFNLSNELVNIWSHALGLILVLAIALYFYPNTANFTLSTKSDVFVAGVFFVMACLTLVCSTVWHTMNAVADVDAISIFACVDYTGISLLIAASIMTTEYTAFYCDPVSRYVYMGLTAFLGIGGVILPWHPRFNGADMAWARVAFFVGLALTGFMPMVQLGWTHGLDFVYNFYSPISKSMLVYFTGAVVYASKIPERWFPGCFDYVGGSHNLWHAAVLGGILFHYSAMQTFFANAFHRAEAGCPSY*


> Fusarium oxysporum (PQRA4B1) NCBI Genome

MAFKLRFRVSPPQTPEAHKGKEMEPINNSALKAARRVLRSLDQMPQWFRHGFNKWILGGYRDISGSFHASLCSLLYVHNESVNIYSHLIPAIFLLLGQHYHASGYSGITGADFIAFSIFMLSAVTCLLLSAMYHIFMNHSQRIEHLCLRLDMMGVVIFILGDLILGVYMVFWCEPFLRKTYWSMIGALGTLAIFVTMHPKFQGPKYRLFRTLVFVATGLSGVTPLIHGINAFGMSQMMSKAFPYTLAKAGCLLFGTWFYVARFPESLYPGKYDLCGSHSIFHVLVVCAFVVQLIGYLDAFDYANTNLTCSTL*


> Fusarium oxysporum (PQRA4B2) NCBI Genome

MASPLRSRLSSLQTPEPTSDAVSESGKAARPILLSYDQMPKWFRQESNKYILSGYRDISGSFITSLCSLSYLHNESVNIYSHLIPAVFFFLGEWYIQQYSEVTGADSIALSIFMLAAVTCLSLSVAYHTLMNHSKRVGHFCLRLDMLGVVVFILGDLVLGIYLVFWCERLLRNIYWSLVAVIGMLNIFVTMHPKFQGPEYRLLRTLMFAATGFSGVSPLVHGINMFGLSQMLRKAFPYTLAKAGCLLLGTSFYLSRFPESQYPGEFDLCSSHSIFHILVVCAAIVQLAGYLDAFSYAHANLTCQSL*


> Fusarium oxysporum (PQRA2A) NCBI Genome

MANPSPEPRTVALHDIPQWRQGNKYILAGYRPMKANYPQVIKSLSFLHNETWNVYTHLIGAVLLPPYATAILRTISGPQYIDVTRIDFIMFNIFFCSAESCLSSSAVYHLIGSHSHEAELLWHRRDLIGIVILTVGTFIPGIYYIFYCDPILQKIHWIIVCGSATAALISIPKFRTLRWRKARVSAYVALGASALIPLLHGVQVYGLEYMLEYSGMKWYLVELLLYGGGCGIYAVRIPERIAPGHFDIWFSSHQIFHISILCAICVNVIALMEAFTACHTLDICYIQSVHQARGTRL*


> Fusarium oxysporum (PQRA2B) NCBI Genome

MDNPSPEPRTVALHDIPQWWRQENEYILAGYRPMKANYRQVIKSLSFLHNETWNVYTHLIGAVLLPPYATAILRTISGPQYIDVTRTDFIMFNIFFCSAESCLSSSAVYHLIGCHSHEAEQLWHRRDLLGIVILTVGTFIPGIYYIFYCDPILQKIHWTIVCFCGSATAALISIPKFRTLRWRKARVSAYVALGASALIPLLHGVQVYGLEYMLEYSGMKWYLVELLLYGGGCGIYAVRIPERIAPGHFDIWFSSHQIFHVSILCAICVNVIALMEAFTACHTLDICYIQSVHQARGTKL*


> Fusarium oxysporum (PQRA2C) NCBI Genome

MANPSPTTRTITWHDIPEWRRDNKYILAGYRPLEADYLQVIKSLTFLHNETCNVYTHLIGAVLLPLFAAAILRTIYGPQYIDVTRTDFIMFSVFFCSAESCLIFSAIYHLIGSHSHEVEQFWHRMDLLGIVIVTVGTFIPGIYYIFNCEPFLQKIHWTIVCHPGSATAALISIPKFRTLRWRKVRVGAYVALGASAFIPLLHGVQVYGLDYMLEYSGMKWYLVELLLYGGGCGLYAVRIPERFAPGHFDIWFSSHQIFHVSILCAMYVHTVALTQAFTACHTLDICHIQSVHQARGTKL*


> Fusarium oxysporum (PQRA2D) NCBI Genome

MANPSPISRTVTWHDIPEWRRDKHIPTGYRPLEPDYLQVIRSLIFLHNETCNVWTHLIGALLLPLFAAAILRTVSRPQYMDVTRTDFIMFIVFFCSAELCLVFSAVYHLTESHSHEVEQFWHRRDLLGIVIVTDGSFIPGIYYIFSCEPILLKVHWTIVCHPVVVCGSATAALISIPKFRTLRWRKVRVGAYVALGASAFIPLLHGVHVYGLEYMFQYSGMKWYLVELLLYGGGCGIYAVRIPERFAPGHFDIWFSSHQIFHVTILCAMYVHTIALMQAFTACHTLDICHIQSVHQARRTRL*


Dikarya; Ascomycota; Saccharomyceta; Pezizomycotina; Leotiomyceta; Sordariomyceta; Sordariomycetes; Hypocreomycetidae; Hypocreales; Hypocreaceae; mitosporic Hypocreaceae; Hypocrea; Hypocrea jecorina (anamorph Trichoderma reesei)
> Trichoderma reesei (PQRA1) JGI Genome

MPTNQQPSSSSSSTKLSSLLSWDDLPAWRRDNAFILTGYRPIIPSYAASARSLLYLHNESVNIWSHLSGAIVAILTAAYLYLVIRPRYESATSSDVLVFACFLGSGVVCLGMSATYHALTDHSPEVAKWGNKLDYTGIVALIVGSYVPALYYGFFCHPVLMAEYLYLICLLGIGCVVVSWVEQFRTPAWRPYRALMFVSLGLSGVIPVCHGLLSFGYQTLENMMSLSWVVLHGLMYIVGAVLYAARWPERSYPGAFDIWGHSHQIFHMFVVFAAATHFYGMAKAFDYHHQHKDSLCSGQ*


> Trichoderma reesei (PQRB) JGI Genome

MAGVTTALTSACGFSHDSDAASSTATSGSDPRREAQQARRRRHSFFIPRRKSIVGHIMEGEENLLLKVDLFLTELERRLEFIENYVDLSKDSSISRAFSTLQAVRTRCSQASEEVIGAGRRRLHIMVETLETRYQETLEATETLHDKAVLGIELLEGMLSEFESRAYKLREQGFANAATAAEAFMDEGRRVANESIERAKSVVDEGIERAVRAALSLEEHIQQAVLLARDRGLLLYDELPTPWRNNPHILKGYRFRETKIECITSVFNMSNEFINIWSHALGLILVLAVALYFYPSSANFYLSTKTDVVVAAIFFMMACLTLVCSTIWHTMNAVADANAVSMFACVDYTGISLLIAASIITTEYTAFYCDPISRWTYMCLTAMLGIGGVILPWHPKFNGADMAWARVGFFVGLALTGFMPILQLYFSHGPEFVYNFYSPISKSLLVYLSGAIVYASKVPERWFPGCFDYIGGSHNLWHAAVLGGILFHYTAMQEFFANAFSRAEGGCPAY*


> Trichoderma reesei (PQRA4B) JGI Genome

MASAARLRLASPQPPVAPKERGNDFLSPRPADSTSRVTKAARKVLLAFEELPEWHQDNEFIRHGYRPISGSAKVSFQSWSYIHNESVNIFSHLIPAVAFLLGEWYILEYLTSRYSNVTGTDFFIFSFFLLTAVVCLGLSATYHTLTNHSSEVEQLFLRFDLVGIVILTLGDFVSGIYMVFWCEPLQRKIYWSMIAILGSLTIFIMLNPRFHGQKYRTFRTLAFVGTGLSGFAPLIHGITIFGFSQMMKQSGMPYYLVEGGFLLLGALVYATKFPECRWPGKFDIYGASHQLFHILVVLATVTQLIGILDAFDYNYTNRRCSSL*


> Trichoderma reesei (PQRA2) JGI Genome

MSTTTNGTAQHPKTNNPRTVTWREIAEWQFDNKYILTGYRPEKADYLEIFTSLTFLHNETCNVYTHLIGAVLLPLVTPVLLRLLAEPRFLNVSSIDYAMFGVYFGCAEICLVLSALYHLMQPHSHPVEMFWHGMDLLGIVIVTVGTFSSGIYYVFFCEARLQKLHWAIILTTGTVTGVLISHPLLRTPLWRKVKVGAFVVFGASSFIPLLHGVQRYGLEYMLQYSGMKWYLVELSFYGTGVGLYAFRIPERLAPGRFDIWGSSHQIFHVAILCAMAAHVTALLQGFTTCHTLDVCKLQGVY*


> Trichoderma reesei (PQRA3B) JGI Genome

MEERNPLVKDNKPGHLWLRVPRLLYFHEIPSWQQDNEYLLSGYRPTSGSTWTSIAGLFYLHNQTINIYSHLVGAVVFCVLPFYFYWNFYRFQPNAHLDDVIVISTYCLGVAVCFTFSATFHIMWNHSQPLTSFCNKLDYLGILVLMWGAGIPTIYYGFFCNQNLQWLYWMTTSSTALLCTIVTLHPRFISPHFRHWRACFYAGFGLSSVIFVVHGLLIHGWAVQKAHMSLNWMAWMATSNILGAAIYAARIPERWFPYTFDIFGASHQIFHVAVMVAAVIHFCGLLQAFTIIRSNAAVCFRS*


Dikarya; Ascomycota; Saccharomyceta; Pezizomycotina; Leotiomyceta; Sordariomyceta; Sordariomycetes; Hypocreomycetidae; Hypocreales; Hypocreaceae; mitosporic Hypocreaceae; Hypocrea; Hypocrea virens (anamorph Trichoderma virens)
> Trichoderma virens (PQRA1) JGI Genome

MAADSSLRNRRLSVSDSLLTAVKQAERKVEQKLLLLWDDLPSWRRDNAFIRSGYRPIRPSYAESARSLFYLHNEFVNIWSHLAGAVVAILTALYVYVVVRPRYEAANSSDVLVFACFFGSAVTCLGMSATYHALTDHSQEVAKWGNKLDYTGIVALIVGSYVPALYYGFFCHPVLMAEYLNLICLLGLGCIIVSWVERFRTPAWRPYRALMFVSLGLSGIIPIGHGLLKFGYQALEDRMSLSWVVLHGIMYIFGAFLYAIRWPERSNPGAFDIWGHSHQIFHMFVVLAAATHFYGMAKAFDHHHQGMGSQCL*


> Trichoderma virens (PQRB) JGI Genome

MAGVTTALTSACGFSHDKDAASTADASGSDPRRDAQQAKRRRHSFFIPRRKSIVGHIMEGEENLLLKVDLFLTELERRLEFVENYVDLSKDSSISRAFSTLQAVRTRCSQASEEVIGAGRRRLHIMVETLETRYQETLEATESLHDKAVLGIELLEGMMSEFENRAYKLREQGFANAATAAEAFMDEGRRVANESIERAKIVVDEGIERAVRAALSLEEHIQQAVLLARDRGLLLYDELPSPWRNNPHIKRGYRFRETKIECVQSIFNMSNEFINIWSHALGLILVLAVAFYFYPSSANFNLSTKTDVVVAAIFFMMACLTLVCSTIWHTMSAVADVKAVSMFACVDYTGISLLIAASIMTTEYTAFYCDPISRWTYMLITALLGIAGVILPWHPKFNGADMSWLRVGFFVGLALTGFMPILQLSFSHGPEFIYNFYSPITKSLLVYFSGAVVYASKVPERWFPGCFDYIGGSHNLWHAAVLGGIIFHYTAMQEFFSNAFHRAESGCPAY*


> Trichoderma virens (PQRA4B) JGI Genome

MAPGEQGNDSPSPRFPGSTSKAGKARKVLISFDELPKWHQDNEFILHGYRPISGSAQVSFHSWSYIHNESVNIYSHLIPAIVFLLGEWYILEYLTSKYSNMTGADFFIFSFFLLTAIGCLGLSTTYHTLMNHSSEVEQLWLRLDLVGIVLLTLGDFVSGIYMVFWCEPLERKIYWSMIGILGSLTIFIMLNPYFQGQKFRAFRALAFVGTGLSGFAPLIHGIKMFGFSQMMKQSGMPYYLIEGGFLLLGALVYVTKFPESRFPGKFDIYGSSHQLFHILVVFATVTQLIGILDAFDYNYVHRTCSSL*


> Trichoderma virens (PQRA4A) JGI Genome

MALYRRLSPAGGNEALDGTSDSRNENLRGSKTTRRLLTAGEVPSWYAHNSYIRTGYRPVTNSAKLCFESLGHVHNETLNIYTHLVPAGIAVVGNYSFYVYFSSHYPDASWRDQLVFHIYLSTSIICYGISSMYHTLLCHSETWASLWARMDYVAIVFQILGSFISGIYIGFYCEPNLQKLYWTMIGTLGLLTGIVVVSPGLQSAKWRMLRLSTFVATGFSAFAPIIHAATIFPYDQLDKQAGLRYYYLEGLSILTGVMFYVTHFPESRIPEKFDIFGASHQIFHSFVVLGGVIHFYGILNAFDWNYNNPRCGL*


> Trichoderma virens (PQRA2) JGI Genome

MSTTNEPTDQPKADKSRTVTWQEISEWQFDNKYILSGYRPEKADYLEIFTSLTFLHNETCNIYTHLIGALLLPLITPAFLWFLAEPRFFNVSSMDYAMFGVYFWCAEICLVLSALYHLIQPHSHRIESFWHGMDLLGIVIVTVGTFSSGIYYVFFCEASLQKLHWAIILTTGTVTGVLISNPLLKTPRWRKVKVGAFVVFGASSFIPLLHGVQRYGFEYMLQYSGMKWYLLELTFYGTGVGLYAFRIPERLAPGRFDIWGSSHQIFHVAILCAMYTHVTALLQGFMTCHTLDVCQLQGVH*


> Trichoderma virens (PQRA3B) JGI Genome

MERNPLVKQHKSDHIWLRVPRLLYFHEIPPWQQDNEYLLSGYRPTSGSTWVSFAGLAYLHNQTINIYSHLVGCIVFCALPFYFYWNYYRLQSNAYVDDLVVISIYCLGVAVCFAFSATFHILWNHSQTLTSFWNKLDYLGILVLMWGAGIPTIYYGFFCNQKLQWFYWMTTSSTALCCTIVTLHPRFISPQFRRWRACFYGGFGLSSIIFVIHGLILHGWELQKEHMSLNWMAWMATSNLTGAVIYAARVPERWVPHKFDIFGASHQILHVAVMIAAVIHFCGLLNAFSIIRSKVDACVN*


Dikarya; Ascomycota; Saccharomyceta; Pezizomycotina; Leotiomyceta; Sordariomyceta; Sordariomycetes; Hypocreomycetidae; Glomerellales; Glomerellaceae; Glomerella; Glomerella graminicola
> Glomerella graminicola (PQRA1) NCBI Genome

MTVSNTSADGAPGVVRNRNRRPSAAAAAAEGLLSSVESTVAGLEKKVEEALLVLWDDLPAWRRDNAFILTGYRPDSNSYLGSLRSLGYLHNESVNIWSHLLGAVAFLVAGAVLHGVVAPRYGTAAPADVLVFACFFAGAVACLGMSATYHAISNHSPEVAKWGNKLDYSGIVFLIVGSYVPALYYGFYCHPGLMKFYLSTVSRLVPKINLLGLGCGAVSWIEFFRAPEWRTFRACMFVALGTSGVVPVLHGAVIYGRAEMEARMSLSWVVLHGAMYIFGAFLYAFRWPERSSPGTFDIWGSSHQLFHFFVVAAAATHLYGMAKAFDYNHSVRGSLCP*


> Glomerella graminicola (PQRB) NCBI Genome

MYSCYTQQVDLFLTELERRLEYLENYGELTFDSSISRAFSTLQTVRARCSHASEEVLGAGRRRLHIMVETLETRYQGALASAESLNEKARVGIELLDDMLSEFENRAYKLREQGLANAADAAGAFMSEGRRVVDGGIELAREVVDEGIERAMRAAESLEEKIALAVARARETKLIAYDDLPMPWRINPHIREGYRFTESKLECIWSAFGLSNELVNIWSHAIGLFIVLAVALYFYPRNANFQFSTKTDIFIAAVFFFTACLTLVCSTIWHTMNAVADVDAISIFACVDYTGISLLIAASIVTTEYTAFYCDPVSRWLYMGTTAFLGIGGVILPWHPTFNGADMAWARVAFFCGLGATGFLPILQLYFSHGPDFVWEFYTPIGKSIFVYLLGAFVYASKIPERWCPGMFDYIGGSHNLWHLAVLGGILFHYTAMQSFFANAFRQAQGECSIF*


> Glomerella graminicola (PQRA3B) NCBI Genome

DWLTNLVYRKACNSVLECFASWAYIHNESVNIYSHVFGAVLFVLLPFYVFGNGIPPRWGIASTADVVVCSVYALGVTVCFVLSAAFHTLMSHSEAVYLSGIKADFHGVLVLMWSSVYPLAHYAFPCSPRTRDAYVALTGLLAALCAAATARPDLGAVDLGHHRAALFAAFGLAAFVLPIGHGAAVDGAGEVWERVGGGWVLATAGFNLVAVLVYWAKVPERWFPRTFDLVGASHQIMHIMVSEKCPSRRDTGSSCIEDIGC*


Dikarya; Ascomycota; Saccharomyceta; Pezizomycotina; Leotiomyceta; Sordariomyceta; Sordariomycetes; Hypocreomycetidae; Glomerellales; Plectosphaerellaceae; mitosporic Plectosphaerellaceae; Acremonium; Acremonium alcalophilum
> Acremonium alcalophilum (PQRA1) JGI Genome

MPSVTSSDGPRNRRGPTATVLTTVTNPAPDPKLVAVQEQHGRVRIRLLTWDDLPAWQRDNTFLLTGYRQASSSYRASLASLAYLHNETVNIWSHLVGALLFVLLAAAGLYGAVFLGHEIAPRYATASRADVLVFACFFAGAVACLGMSATFHTLSNHSPAVARWGNKLDYAGIVLLIVGSYVPALYYGFRCDPELMVMYQSIITLLGLGCGITAWMDRFRTPAWRPVRAAMFVALGLSGIVPVVHGLKLYGRDALERRMSLSWVVGHGALYVIGAFIYAVRWPERRFPRRFDIWGSSHQIFHFFVLAAAATHCVGMGKAFDYHHGGMAAEC*


> Acremonium alcalophilum (PQRB) JGI Genome

MTTLPSSSCACSAQGDEPVDIGVSSSAQVQGNIRPRRRRHSFFIPRRKSIIGHIMDTEEGILLKVDLFLSELERRLDFIENYGDPLDSSISRAFSTLQAVRERCGQASEDVLGEGRRRLHVMVETLEARYHEGLTSAESLHEKARLGIELLEGMLSDFETRAHHFREQGLANAAGAAGAFMTEGRRVVDESIERAMRAAETLEEHIQYAIVRARETGLIMYDELPVPWRINPHIRRGYRFTETKIECVRSAFGVHNEAFNIWSHALGLVVVLAVALYFYPRNDNFSLSSQTDVFIAAVFFSTACLTLVCSTIWHTMNSVADINAISIFACVDYTGISLLIAASIMTTEYTAFYCDPVSRWIYMTMTALLGAGGVVLPWHPTFNEADMAWARVAFFVGLAATGFAPIIQLCFTHGPDFVLQFYSPIFKSIFVYLVGACVYASQVPERWFPGMFDYIGGSHNLWHLAVLGGILFHYTAMQAFFANAFHRAQGECSPY


Dikarya; Ascomycota; Saccharomyceta; Pezizomycotina; Leotiomyceta; Pezizomycetes; Pezizales; Tuberaceae; Tuber; Tuber melanosporum
> Tuber melanosporum (PQRA1) NCBI:CAZ79878.1

MAVKNRNTQRGGAGGGSAGEMVVEGAKNAEKKVEEALTVLLHELPLWMQDNHFIVSGYRPQSFSFYKSFHSLTYLHNETVNIYTHLLPALLFLLLGTYTVKTHLLPRYPTSTAPDLLSFACFFASASTCLGILAVARVGNKLDYLGIIILIMGSFIPSVHYAFYCRRRLAYAYWSMISLLGAGCAAVSVMPGFRTPAWRPFRAGLFVSMGLSSVLPVLHGVRIYGTRGMDERMGVRWLLIEGLLYIAGAGIYAARVPERFAPGRFDLLGASHQLFHCLVVAAAGSHLVGLVKGFDYLHSGDAQVCG


> Tuber melanosporum (PQRB) NCBI Genome

MCSHASMDRKLGQAMRGVEAVIDAKDKLAESIERAIKAARERRLITYEELPFPWRVNPYITRGYRFTETKLECVRSAFALNNETCNIWTHGLGFILILAIAFYFYPMSQIFNNHTTADKFINGLFFLAAAKALACSTIWHTFSSISHQTTMERFACVDYSGISMLIAASIITTEYTAFYVEPISRSIYITITFLFGVAGVILPWKPAFNRADMRVWRVAFYVTLGATGTIPMIQLSITRGRSWVALFYLPVLKSVCPRAVYIAGALIYAMQVPERFYPGCFDWIGGSHNIWHVCVLGGILFHWHAMHDLFHRAFEMATA*


Dikarya; Ascomycota; Saccharomyceta; Pezizomycotina; Leotiomyceta; Sordariomyceta; Leotiomycetes; Erysiphales; Erysiphaceae; Blumeria; Blumeria graminis
> Blumeria graminis (PQRA1) NCBI Genome

MSVRRRLPEIISPVVGILKGDTNLKPQTIHWSELLPWQRDNHYIQTGYRPSSLSFRKSFASLLYLHNESVNIYSHYIGAILFATLASGLYTLMRPRYETATPIDVLVFSCFFIGAGICLGISGTYHTISNHSPLVARWGNKLDYVGIVFLIVGSFIPSIFYGFYCHPQFQNFYWTMISMLGLACAAVSVFDRFRTPAWRPYRAGIFVSLGLSALFPVGHGVRLYGLLEMRNRIGLFWLVLQGLLYILGAALYAARWPECSWSNRFDIWGSSHQLFHILVVMAAICHLYGLLVAFDFHHTVLGAGCYLLQETGQ*


> Blumeria graminis (PQRB) NCBI Genome

MNPTFILLTGRSSLQVDHFLLELGRRLDYLESYGNLNLDSGISRAYATLQAVRARCSHVSGEVMCAGRKRAKIIVETIESRYQNTLAVKETLHDRVHDGIGFLEVILSDFEKTAHKMKEQGFASAAGTLMDGGRRVVDEGIGRAKKAAESVEIHVQAAILRAKEHGLIRYEDLPVPWRVNPHITKGYRFTESKLECLRSMFDISNESVNIWSHAIGLLIVLSIALYYYPTSANFLMSTKTDIFIAAAFFFAACKCLVCSTLWHTMNSVADQNLMERFACVDYTGISLLIAASIMTTEYTAFYCEPVSQWIYLSSTALLGIGGVILPWHPTFNRAELAWARVAFYMSLGATGLAPACQLLLTRGSAWAWEFYAPITKSLLVYTVGAFVYASQIPEKWYPGAFDYVGGSHNLWHCAVLIGILFHYVAMQEFFSRAFEQASNGCSVS*


Dikarya; Ascomycota; Saccharomyceta; Pezizomycotina; Leotiomyceta; Sordariomyceta; Leotiomycetes; Helotiales; Sclerotiniaceae; Botryotinia; Botryotinia fuckeliana
> Botryotinia fuckeliana (PQRA1) NCBI:EDN23854.1

MSARQRRPSTTSTTELLFETAKNIERRVESSLTVLWDDLPSWQQDNHYIKSGYRPATASFQKSFASLGYIHNESVNIYSHLVGAVVFTLSGFLLYAIIKPRYASAEIADVLAFSCFFAGAALCLGMSGTYHTISNHSPTVAKFGNKLDYLGIVSLITGSVIPGIYYGLYCHPHLFEFYSTIVGALGGICAVVVMLERFRTPAWRPYRAGIFVALALCGAVIPILNGIQLYGFHAMRERAGLTWLLLEGFFYILGASLYAVRWPERTSPGSYDIWGSSHQIFHMLVLAAAASHLYGLTIGFDYYHNGLGLKC*


> Botryotinia fuckeliana (PQRB) NCBI:XP_001549962

MVCAASSLTVESYEDVTTSTMASGREEAKPLSKRRHSSFHPRRKSSEQVMDGEESLMLKVDLFLSELERRLDFIEKYGNLTFDSSILWSYATLQAVRERCSQVSGEVLGATKRRARIMVDTVESRYQDALVAHETLHEKVHTGIGLLEGILSEFETRAYRVKEKGLRGTAESLMGEGRKIVDEGLEKAREVVDEGFERAKKAAGTVEEHIENAIARAKKHGLIRYEDLPTPWRVNPHIVKGYRFTESKVECVQSMFGLSNETVNIWSHAIGLLIVLSVAFYFYPSSHAFSLSTNADVFIAACFFFAACKCLVCSTMWHTMNSVADQTLLERFACVDYTGISLLIAASIMTADYTAFYCEPVSRWVYMGITAALGLGGVILPWHPTFNRQDMAWARVAFYVSLGATGFVPALQLNLTRGGAWAAEFYAPLAKSITVYLVGAFVYASQVPERWCPGAFDYVGGSHNLWHFAVLGGILFHYVAMQEFFANAFARAENGC*


> Botryotinia fuckeliana (PQRA4) NCBI:partial EDN31324.1

MVYTESRFSHLSYSTVGHGRTDSPTIIDNAFTPVSGIGIAIPYPVLQRTFLFDATPPPSPVYQKFKYPSSVPPSTPQGKKDLINFDKLPEWSQDNPHIHSGYRQISHSTSTCLYSCFQIHNETFNIWSHFIPCILFIILEGIIMYYLNTRYPNATIKDYIVFSFFILCATICLGISSIFHSLISHSQKGHDLWLKLDYVGIVFLIIGCFISAVYMSFFCQQTLQYAYCGMVSYLSLFHFCILLLLPTFQGHRWRSFRVVAFCATAVSVLIPFVHTIAQSGWNKAMEQSGMPYYFAEALLLLVGVVCFAVKRWPESWIPGSFDLLGNSHQIFHLLVVLALVLHLVGLLQAFDYNYVKGECRGTSS*


> Botryotinia fuckeliana (PQRA3B1) NCBI:partial EDN17938.1

NHFIETGYRAASNSLRECFASWGYLHNETVNIWSHLIGAALFVALPVYLYKAEIPPRYAVATKEDIVVCGMYFLGVAICFCLSALYHTVMNHSQQMDTFGAQLDFQGVILLMWGATIPLVYYGFYCDTAIHRYSYWALVCSLPVCCSVSTFQPHFRDPFLRPVRAATFGSLAVVTMVPVVHGATIYGWRVQNQRMGITWVLITLMLNVLGATAYAIKFPERWFNKSFDLFGASHQLFHMMVVLAALVYSKAILQAFDFAHAYDHTCNR*


> Botryotinia fuckeliana (PQRA5) NCBI Genome

MEVNQIASTSALLENVAPISSGKLHDNTARILGKIVDFYHLPDWMQKDAHITRGYRAETKSFRACFHSLWYLHNESVNTWSHLISGTAFLAMLLWSFLPALHGQYDIPAGPLNAVRCQLVATAICLYLSAFYHCVSCHSFHVSKICLKLDYLGIVLNISFTWISAIYFGLYGHRELTRWYITQICICACITFWVMLSPKMDGPQTALYRSIAFLSLGASGFAPMIHAALMDHISLKNFPLFYMITSTILFLTGTAVYVTRTPEKYWPGVFDVWGASHQIFHVLVNIAQISHILGLIEALTKLSEISN*


> Botryotinia fuckeliana (PQRA3B2) NCBI:partial EDN30043.1

DNEYIISGYRPASNSLLTSLWSLGHIHNETVNIYSHLFGSILFATLPFSLYRQIAPRYATATIADIVVFSTFFFGVAICFLLSATYHLLANHSKRVNALGNQLDYLGVVILMWGSTIPTVYYGFYCDPAIQETYWIMVNRLFPACAITTLHPKFRHSAFRPYRAIMYSCLGLSSITFVIHGLILYGYDTQNWRMSLDWMGIMAGFNLFGAFAYAARIPEKWFPRRHDILGSSHQILHFMVIFAGLAHMAGLLRAFDHIHSDTFQCI*


> Botryotinia fuckeliana (PQRA3B3) NCBI:partial EDN23527.1

QDNEFILTGYRPETKSSLRSLLSIFHLHNETVNIHSHLLGAVLFALLPLYVYQMLVPRYRDATMADRVVFALFFAGVAGCFALSFLYHTLNNHSHKIASFWIELDYLGIVALMWGSTVATIYHGFTCDVKLQRIYWSMVHILPFLPPSSLHLPPFRTPFFRPYRTLMYAALGLSAVIFIVHSIILYGVALQYKRLSLGWIAGMAGLNFLGALAYSLRIPEKYFPGRFDIYGNSHQILHCMVVLAALAHFAGLVQSFDYAIRVGGRSVL*


Dikarya; Ascomycota; Saccharomyceta; Pezizomycotina; Leotiomyceta; Sordariomyceta; Leotiomycetes; Helotiales; Sclerotiniaceae; Sclerotinia; Sclerotinia sclerotiorum
> Sclerotinia sclerotiorum (PQRA1) NCBI:partial EDO04322.1

MSTRQRRPSTTSTTELLSETAKNIERKVERALTVLWDDLPSWQQDNHYIKSGYRPATSSFRKSFASLVYIHNESVNIYSHLIGAVVFTLSGYFLYATIRPRYASAETADVLAFSCFFAGAALCLGMSGTYHTISNHSPTVARFGNKLDYLGIVFLITGSVIPGIFYGLYCHPHLFEFYSTVVGVLGGFCAVVVMLERFRTPTWRPYRAGIFVALALCGAVIPILHGIEINGFHEMRERSGLTWLLLEGFLYILGASLYAVRWPERTSPGSYDIWGSSHQIFHMLVLAAAASHLYGLAIGFDYHHNGLGLKC*

1   2   3   4   5   6   7   8   9   10


Verilənlər bazası müəlliflik hüququ ilə müdafiə olunur ©azrefs.org 2016
rəhbərliyinə müraciət

    Ana səhifə