If no accession number is given or only a partial protein sequence is found in the database then the protein sequence was derived from genomic sequence. Grey shading indicates genomes that are complete according to ncbi




Yüklə 371.95 Kb.
səhifə5/10
tarix23.04.2016
ölçüsü371.95 Kb.
1   2   3   4   5   6   7   8   9   10

> Talaromyces stipitatus (PQRA2A) NCBI:partial EED11745.1

MNPTNDPIYQPERTVTGQKIFGWQFDNKYILRGYRPANADYPKIFRSLTFLHNESCNVYTHLIGALLLPLVATTLLRYLAEPKFLNVSTMDYAVFGIYFWCSEVCLILSALYHLMQPHSYQVEQFWHGMDLLGIVFMTVGTLFSGIYYVFFCEASWQQLHWAMVRIFGIQVLAMGTVTSILISNPLLKTPRWRNIKVGTFIIFGASSFIPLLHGVQ*YGLDYMLQYSGIRWYLLELTFYGAGVSLYTVRIPERLAPGKFDIWGSSHQIFHVAICWRCGTV*


> Talaromyces stipitatus (PQRA2B) NCBI:partial EED11851.1

MSTTSQPKTEERTVTWQKISEWQFDNQYILRGYRLPKADYLEILFSLTFLHNESCNVYTHLIGALLLPLVAATLLRYLAEPQFVNVSSMDYSMFGIYLGCAEICLVLSTLYHLMQPHSHQVEQFWHGMDLLGVVIVTVGILSSSIYYVFFCEASLQKLHWAIVVLTTGTVTSVLISNPLFKMPGWRKVKAGTFVIFGSSSFIPLLHGVQRYGLEYMLQYLGMKWYLLELTFYGIGVSVYAVFRFPERLAPGKFDIWGSSHQIFHVAILCAMYTHQAALL*GFVTCHTLDVCQLYG*


Dikarya; Ascomycota; Saccharomyceta; Pezizomycotina; Leotiomyceta; Eurotiomycetes; Eurotiomycetidae; Onygenales; mitosporic Onygenales; Coccidioides; Coccidioides imitis
> Coccidiodes imitis (PQRA1) NCBI:XP_001244157

MERLRAEVSAVQRRQVTIQTEAESADGTVTATKVVKTTVRTVHWDDLPHWLRDNQHIHTGYRPASESFVKSFKSLGYIHNETVNIYSHLFPALLSIPLSFTIYRAISARYETANHADVAAFSCFFAGAAFCLGMSALYHTISNHSPLVAYIGNACDYVGIVGLITGSFIPSIYYGFYCMPNLQILYWSMICALGLGCAIVSTIPRFRTPAWRPFRATMFVSMGLSAVFPLVHGVAVFGFAQMRWQIGLWWLLLQGFLYILGAAIYAMRVPERLWPGKFDILGHSHQIFHVLVVLAAYAHLTGLLEAFDYRHSGIAPACAG*


> Coccidioides imitis (PQRB) NCBI:XP_001240828

MACSSPSMTVESHADREDTGATSGFFSPTEILRNRRRRHSFHSSRRLSCDYDADAIFLRVELFLADLERRLQWLEDYRQSHVVDIDSGLKRAYAALQAVRDKCSHASGELMGGGKRRARIVVETMEEQYNHALATKETLEQKAQASMRLMESFLSELEASVHAVKDRGIYVAIDEGWRAVDSGLHHARVVLDEGMERARHAQVALRESIDRAIQLAQEKRLITYADLPHPWRVNPHILDGYRFTTSKIECVTSVFTFSNELVNIWSHLIGLIIVLAVALYFYPLSPNFSLSTKADVAIAAIFFIAACKCLVCSTVWHTMNGIASQSLMERFACVDYTGISFLVAASIVTTEYTAFYCEALSRWIYILMTSSLGIAGIILPWHPTFNRADMAWARVAFYVTLALTGFAPIVQLSLTRGLAWSLYFYAPIMKSLLVYLTGACIYASQVPERWRPGFFDYFGGSHNIWHIAVLGGILFHYHAMQDLFAGAFVRAQGECPSL*


> Coccidioides imitis (PQRA4C) NCBI:EAS34144.1

MGKAISVSSIPRCRGAAPSLWPLEAEQEPLLSPPYANKSTVPTKKGPILLSFEEAPHWLQDNEYILSGYRRPNQSVTDCIASLTYVHNETANIYTHMIPGLFLVVGEILLYQNFLSFYPEATEADRLVFASLLFAALICMSFSTGYHTLMSHSHSVSRLWLQMDYIGIMALILGNILTGTYMVFYCVPHLIWLYWGTVLTLGSLSCMIILHPKLQGQEWRNFRTGTFACTGLSSLAPLAHATLMFGLSGMFEHSGLPYYLLEGLLHITGVFFYAQTRIPESLNPGQFDIWFSSHQIFHVLAVLATVAQVFGVWHAFDYNYTNGLACDAS*


Dikarya; Ascomycota; Saccharomyceta; Pezizomycotina; Leotiomyceta; Eurotiomycetes; Eurotiomycetidae; Onygenales; mitosporic Onygenales; Coccidioides; Coccidioides posadasii
> Coccidioides posadasii (PQRA1) NCBI:EER26494

MERLRAEVSAVQRRQVTIQTEAESADGTVTATKVVKTTVRTVHWDDLPHWLRDNQHIHTGYRPASESFVKSFKSLAYIHNETVNIYSHLFPALLSIPLSFTIYRAISARYETANHADVTAFSCFFAGAAFCLGMSALYHTISNHSPLVAYIGNACDYVGIVGLITGSFIPSIYYGFYCMPNLQILYWSMICALGLGCAIVSTIPRFRTPAWRPFRATMFVSMGLSAVFPLVHGVAVFGFAQMRWQIGLWWLLLQGCLYILGAAIYAMRVPERLWPGKFDILGHSHQIFHVLVVLAAYAHLTGLLEAFDYRHSGIAPACAG*


> Coccidioides posadasii (PQRB) NCBI:partial EER23006.1

MACSSPSMTVESHADREDTGATSGFFSPTEILRNRRRRHSFHSSRRLSCDYDADAIFLRVELFLADLERRLQWLEDYRQSHVVDIDSGLKRAYAALQAVRDKCSHASGELMGGGKRRARIVVETMEEQYNHALATKETLEQKAQASMRLMESFLSELEASVHAVKDRGIYVAIDEGWRAVDSGLHHARVVLDEGMERARHAQVALRESIDRAIQLAQEKRLITYADLPHPWRVNPHILDGYRFTTSKIECVTSVFTFSNELVNIWSHLIGLIIVLAVALYFYPLSPNFSLSTKADVAIAAIFFIAACKCLVCSTVWHTMNGIASQSLMERFACVDYTGISFLVAASIVTTEYTAFYCEALSRWIYILMTSSLGIAGIILPWHPTFNRADMAWARVAFYVTLALTGFAPIVQLSLTRGLAWSLYFYAPIMKSLLVYLTGACIYASQVPERWRPGFFDYFGGSHNIWHIAVLGGILFHYHAMQDLFAGAFVRAQGECPGLVY*


> Coccidioides posadasii (PQRA4C) NCBI:EER25359.1

MGKAISVSSIPRCRDAAPSLWPLEAEQEPLLSPPYANKSTVPTKKGPILLSFEEAPHWLQDNEYILSGYRRPNQSVTDCIASLTYVHNETANIYTHMIPGLFLVVGEILLYQNFLSFYPEATEADRLVFASLLFAALICMSFSTAYHTLMSHSHSVSRLWLQMDYLGIMALILGNILTGTYMVFYCIPHLIWLYWGTVLTLGSLSCMIILHPKLQGQEWRNFRTGTFACTGLSSLAPLAHATLMFGLSGMFEHSGLPYYLLEGLLHITGVFFYAQTRIPESLNPGQFDIWFSSHQIFHVLAVLATVAQVFGVWHAFDYNYTNGLACDAS*


Dikarya; Ascomycota; Saccharomyceta; Pezizomycotina; Leotiomyceta; Eurotiomycetes; Eurotiomycetidae; Onygenales; mitosporic Onygenales; Paracoccidioides; Paracoccidioides brasiliensis
> Paracoccidioides brasiliensis Pb03 (PQRA4A) NCBI:EEH19383 NCBI:EEH38208

MALYQRLAPTRSDGSWSNPAKGSAVKQPKTKYRLLVASEVPSWYAHNSFIRTGYRPVNGSVRLCVNSLRFIHNETVNIYSHLIPAGIALASNGLLHLYFCDRYPTASMVDQLALHVYLTSSVVCFGISSTYHTLLCHSEPCSGLWARLDYVAIILQTVGSFVSGIYVTFYCEPCLQKLYWTMTGALGLLSSIILVSPQFQSSRWRLFRLSTFVATGLSGLLPIIHAAFIYPFAQLNQQAGLGYYLVEGLALITGVIFYATHFPESWIPEKFDIWGASHQIFHLFVVLSAVIHTWALLSVFDWIYKNPRCSVLRFRHE*


> Paracoccidioides brasiliensis Pb03 (PQRB) NCBI Genome

MPCTGPSVTLESYVDSKQSSNASGLAVPDERADLLRNTRRRHSFHTARRLSCDYDADAIFLRVELFLTEMERRLQWLEEYRQSHMTHIDARLKRGYAALLSVRDSCSHASGELMGSGKRRAKILVETLEDRYNEVLATKETFEQKAHASMRLMENFLGELELAAQSVRDRGLYSTLDDGWRAVEPSLAHAREVMDESLAHAREVMDESIEHAREALQKKIERAIQLAKEQRLIHYSDLPHPWRVNPHILQGYRFTTSKIECVTSVFTFSNELFNIWSHFIGLIIVLAIAFYFYPSNPNFSASTTTDVAIAGIFFLAACKCLVCSTLWHTMNGIASQPLMERFACVDYTGISLLVAASIVTTEYTAFYCEPVSRWIYIVTTSTLGIAGVILPWHPTFNRSDMAWARVAFYVTLAATGFAPIAQLSLTRSLGWSLYFYAPLLKSLGVYLLGALVYASQIPERWHPGFFDYLGGSHNIWHVAVLGGILFHYGAMQDLFTGAFVRAEGECPTLVV*


Dikarya; Ascomycota; Saccharomyceta; Pezizomycotina; Leotiomyceta; Eurotiomycetes; Eurotiomycetidae; Onygenales; Arthrodermataceae; mitosporic Arthrodermataceae; Arthroderma; Arthroderma otae (aka Microsporum canis)
> Arthroderma otae (PQRA1) NCBI:EEQ27871

MTVFQRRAVTTAHNILYEKDGEEASGVIKKTVEESWTTTVHWDALPLWLQDNHHIHTGYRPASASFVRSFHSLTYIHNETVNIYTHLLPALLTIPISIILYQALSPRYHTADPGDIVVLSCFFAGAAFCLGMSALYHTISNHSPWVAYIGNACDYLGIIGLITGSFIPSIYYGFYCMPQLQRLYWGMIVVLGAGCAAVATVPRFRAPALRPFRAAMFVALGLSAIFPVTHGVVVLGFNQARQQIGLDWLITQGALYILGASIYAARVPECLHPGKYDIVGHSHQIFHVLVVLAAGAHLTGLLKAFDYRHSMAAGC*


> Arthroderma otae (PQRB) NCBI:EEQ29328

MGGGRRRARIAVETLESRYNEALATKETLEQKAQASMRLMEDFLSQLEARVHSVRDRGLYSAIDEGLRAVDSSITHARVMFDEGIERAVHAKIALRESIDRAIALAKEKRLIHYSDLPHPWRVNPHIRKGYRFTASKIECLTSVFSFSNEMVNIWSHLIGLIIVLCVAFYFYPLSPNFSLSTKTDVTIAFIFFIAACKCLVCSTLWHTMNSIANQPLMERFACVDYTGISLLVAASIVTTEYTAFYCEPYSRWIYILMTSTLGIAGVILPWHPRFNGPHMAWARVAFYVTLALTGFAPIVQLSLTRGLEWSLYFYAPVVKSILVYFCGACIYASQIPERWHPGFFDYVGGSHNIWHVAVLGGILFHYLAMQDLFAGAFLRAKGECPCLTS*


> Arthroderma otae (PQRA4B) NCBI:partial EEQ30825.1

MASAPRLRVPPPQPPEGHKGWGMESISDTVSKASKVGRSVLLSFDEMPEWFRRESNQWILHGYRPISGSAHASFCSWSYIHNESVNIYSHLIPAVFFLLGEWYIRQYLTSRYSGVTGADFIAFSVFMLTAVTCLSLSATYHTLMNHSQHVERFCLRLDMLGVVIFILGDLVLGIYMVFWCEPLPRNIYWSLVSIGVSGTLTIFTTMHPKFQGSNYRLFRALMFVATGLSGVAPLIHGLNVFGMSLMMRKAFPYTLAKAGCLLSGTSFYAVRFPESRYPGKFDLWGSHSIFHVLVVCAAVVQLMGYLDAFDYAHANLTCSSP*


> Arthroderma otae (PQRA4A1) NCBI:partial EEQ33555.1

MARKKLTESAPPTPPPRLESPFQYRRLLKFEETPDWFEGNRFILTGYRYESRSAIRSLQSWTYLHNESCNIYSHFLPAVLYLALHWYLFSSYLPSRYQTLSKGDELILSLFLSTVVLCLGASSLYHTFLNHSASIARRWLLCDYMGIITLIQGCFISGIYFGFYCEPYLQRLYWTMVCLQRGLYSTFTSSQFQDPKWRGFRVATFVCTGLSAFAPITHALLLHGLESSIHVGLPYYLTEGIIIAFSAFIYEVSRQIPERWYPGKFDIWGHSHTIFHTIVAVGMCIHLVGLLKALDYTYHNNQCTIE*


> Arthroderma otae (PQRA4A2) NCBI:partial EEQ31543.1

MALYQRLSPVRGERELGKALESTHGLLTKLPSSKYQLLTSNEVPSWYAHNSFLRTGYRPVNGSVRLCIDSLQYIHNETVNIYSHLVPAGIAVIGNFLLHLYFRSYYINASVMDQIAFHVYLSSSVLCFGISSMYHTLLCHSEAYVDIWGRLDYVAIVLQTLGSFISGIYFSFYCEPGLQKLYWTMISVLGSLTATIVVSPRFQSPKWRILRLSTFVATGLSAFAPIIHAATIFSYAQLTQQLGVGYYLLEGLMLITGTIFYAVQFPESWIPEKFDIWGASHQIFHILVVLSSIIHIIGIFTVFDYAYENLQCSA*


> Arthroderma otae (PQRA4C) NCBI:partial EEQ31554.1

MTVLPALRSRGFVAANPSRVDLDETPPLLPRKTQSHGALTLSNKEVPHWLGESNYILTGYRVPCNSTARCFYSWFYLHNETVNIYTHLIPAIGFAAAEIFVYRHFETLYPDAPQADKAVFALFLLTAMTCMSCSTLFHTFMSHSERVSKAYLRADYMGIAGLIFGNIISGTYVVFYRETALWATYWTFVFSALTCMILFHPKFEGQEYRTFRAGTFICTGLSSVAPLMHAIMLYGLEEMMEHSGLPYYLLEGLLHIIGVIFYVVSRIPESLRPGKFDIWFSSHQIFHVLVVLATISQVIGIWSAFDHKYHTEISVRRKLPLLV*


Dikarya; Ascomycota; Saccharomyceta; Pezizomycotina; Leotiomyceta; Eurotiomycetes; Eurotiomycetidae; Onygenales; Arthrodermataceae; Arthrodermataceae; Arthroderma; Arthroderma gypseum
> Arthroderma gypseum (PQRA1) NCBI Genome

MSVLQRRAVTTATAAVYRREEAETEAAQQVEVLKIVEEEVSWTATVHWDALPHWLQDNQHIHTGYRPASSSFLRSFHSLTYVHNETVNIYTHLLPAILTIPMSFILYQALSPRYHTATPADIVVFSCFFAGAAFCLGMSALYHTISNHSPWVAYIGNACDYLGIIGLITGSFIPSIYYGFYCMPQFQRLYWGMIVVLGAGCAAVATIPRFRAPALRPIRAAMFVALGLSAIFPVTHGVVVLGFSQARQQIGLDWMITQGVLYITGAAIYAARVPECLHPGKYDIIGHSHQIFHVLVVLAAGAHLTGLLNAFDYRHSLAIQC*


> Arthroderma gypseum (PQRB) NCBI Genome

MGGGRRRARIAVETLESRYNEVLATKETLEQKAQASMRLMEDFLSQLEARVHSVRDRGLYGAIDEGLRAVDSSITHARVMFDEGIERAVHAKIALRESIDRAIALAKENRLIHYSDLPQPWRVNPHIRKGYRFTASKIECLTSVFSFSNELVNIWSHLIGLIIVLAVAFYFYPLSPNFHLSTKTDVTIAFVFFIAACKCLVCSTLWHTMNSIANQPLMERFACVDYTGISLLVAASIVTTEYTAFYCEPYSRWIYILMTSTLGIAGVILPWHPRFNGPHMAWARVAFYVTLALTGFAPIVQLSLTRGLQWSLYFYAPVVKSILVYFCGACIYASQIPERWHPGFFDYVGGSHNIWHVAVLGGILFHYLAMQDLFAGAFLRAKGECPCLTS*


> Arthroderma gypseum (PQRA4A) NCBI Genome

MPRQKLAGSALTPPRLDSPPIQPPDRLLKFEETPSWFEGNQFILTGYRHESRSAVRCVHSWTYLHNETCNIYSHLLPAGLYAALHWYLLTFYLPSRYNPLSKGDELILSLFLSTVVLCLGASALYHTFLNHSAPVARRWLLCDYMGIITLIQGCFISGIYFGFYCEPYLQRLYWTMVCLGSLTATILLSSQFQDPKWRGFRVAVFVCTGLSAFAPITHALLLYGPQRSMNVGLPYYLAEGAIIVLAAFIYEVQRQIPERWFPGKFDIWGHSHTIFHAMVAVGMCVHFVGLLEALEYTYYNSQCA*


> Arthroderma gypseum (PQRA4B) NCBI Genome

MEVAPRLRVSTPPPSDAQKGRVMKPISNAASKAKRAGRRPALLSFDEMPEWFRRESNKWILHGYRPISGSALTSFSSWSYIHNESVNIYSHLIPAVFFMLGEWYLQQYLISKYSKVTGADFIAFSIFMLTAVTCLSLSATYHTLMNHSQHVEHFCLRLDMLGIVIFILGDLVLGIYMVFWCEPLPRNIYWSMVSIGIFGTLTIFMTMHPKFQGKYRNFRALMFVATGLSGVAPLIHGLWVFGISQMMTKALPYTMAKAGCLLSGTAFYAVRFPESRYPGKFDLWGSHSIFHVLVVCAAVVQLMGYLDAYDHAQANIACSS*


> Arthroderma gypseum (PQRA4C) NCBI Genome

MTVLPALRSRGFVAAHPPRVDLDETPPLLPRKNQLHCAITLSNKEVPHWLGESNYILTGYRVPCNSIARCFYSWFYLHNETVNIYTHLIPAIGFAAAEVFVFRHFETLYPEAPVVDKAVFALFLLTAIMCMGCSTLFHTFMCHSEKVAKACLRADYMGIAGLIFGDIISGTYVVFYSDTALWAFYWAFVFSSLTCMILFHPKFEGEEYRTFRAWTFICTGLSSLAPLMHAILLYGLEDMMEHGGLPYYLLEGLLHIIGVIFYVVSDTQTRAPESLRPGKFDIWFNSHQIFHVLAVLATISQVIGIWSAYDYKYHAEISMLQKLPPFVG*


Dikarya; Ascomycota; Saccharomyceta; Pezizomycotina; Leotiomyceta; Eurotiomycetes; Eurotiomycetidae; Onygenales; Arthrodermataceae; Arthrodermataceae; Arthroderma; Arthroderma benhamiae
> Arthroderma benhamiae (PQRA1) NCBI Genome

MSLLQRRAVTTAAAAVYKREEAELSQHQQQIKAEAEAEAEVLEQESWTATVHWDALPRWLQDNHHIHTGYRPASASFLRSFHSLTYVHNETVNIYTHLLPALLTLPTSFVLYRALSPRYHTATPADIVVFSCFFAGAAFCLGMSALYHTISNHSPWVAYIGNACDYLGIIGLITGSFIPSIYYGFYCTPQLQRLYWGMIVVLGAGCAAVATIPRFRKPALRPFRAAMFVALGLSAVFPVTHGVVVLGFSQARQQIGLDWLITQGALYIIGAAIYAARVPECLHPGKYDIIGHSHQIFHVLVVLAAGAHLTGLLAAFDYRHSLATQC*


> Arthroderma benhamiae (PQRB) NCBI Genome

MGGGRRRARIAVETLESRYNEVLATKETLEQKAQASMRLMEDFLSQLEARVHSVRDRGLYGAIDEGLRAVDSSITHARVMLDEGIERAVHAKIALRESIDRAIALAKEKRLIHYSDLPQPWRVNPHIRKGYRFTASKIECLTSVFSFSNELVNIWSHLIGLIIVLAVAFYFYPLSPNFHLSTKTDVTIAFIFFIAACKCLVCSTLWHTMNSIANQPLMERFACVDYTGISLLVAASIVTTEYTAFYCEPYSRWIYILMTSTLGIAGVILPWHPRFNGPHMAWARVAFYVTLALTGFAPIVQLSLTRGLQWSLYFYAPVVKSILVYFCGACIYASQIPERWHPGFFDYVGGSHNIWHVAVLGGILFHYLAMQDLFAGAFLRAKGECPCLTS*


> Arthroderma benhamiae (PQRA4A) NCBI Genome

MPQQKLADSALTPPRLDSPPIQPPLGRLLKFDETPSWFEGNQFILTGYRHESRSAIRCLHSWTYLHNESCNIYSHLLPAVAYIALHWYLVNIYLPSRYNTLAKGDGLILSLFLSTVVLCLGASSLYHTFLNHSAPIAKRWLLCDYMGIITLIQGCFISGIYFGFYCEPHLQRLYWTMLDTSANNRELQIVVLGSLTATILLSSKFQDRKWRGFRVAVFVCTGLSAFAPITHALFLHGLKRSMNVGLPYYLTEGAIIAFSAFIYEVQRQIPERWFPGKFDIWGHSHTIFHSMVALGMCIHFVGLLNALEYTYYNSQCT


> Arthroderma benhamiae (PQRA4C) NCBI Genome

MTVLPALRSRGFVASRPPRVDLDETPPLLPRKSQEHSALTLSNKEVPHWLGESNYILTGYRVPCNSTARCFYSWFYLHNETVNIYTHLIPAIGFAAAEVFVFRHFETLYPEAPVADKAVFSLFLLTAIMCMSCSTLFHTFMSHSEKVAKACLRADYMGIAGLIFGDIISGTYVVFYSDTVLWAIYWAFVFSSLTCMILFHPKFEGEEYRTFRAWTFICTGLSSLAPLMHAIILYGLEEMMEHGGLPYYLLEGLLHIIGVAFFVVSDIQTRIPESLRPGKFDIWFNSHQIFHVLVVLATISQVIGIWSAYDYKYHTEISLLHRPQSLAG*


Dikarya; Ascomycota; Saccharomyceta; Pezizomycotina; Leotiomyceta; Eurotiomycetes; Eurotiomycetidae; Onygenales; Arthrodermataceae; mitosporic Arthrodermataceae; Trichophyton; Trichophyton equinum
> Trichophyton equinum (PQRA1) NCBI Genome

MSLLQRRAVTTAAAAAVYRREEAETSQQQQQQQQQQQQQTEAETEVEVLEQESWTATVHWDALPRWLQDNHHIHTGYRPASASFLRSFHSLTYVHNETVNIYTHLLPALLTLPTSFVLYRALSPRYHTATPADIVVFSCFFASAAFCLGMSALYHTISNHSPWVAYIGNACDYLGIIGLITGSFIPSIYYGFYCTPQLQRLYWGMIVVLGAGCAAVATIPRFRKPALRPFRAAMFVALGLSAVFPVTHGVVVLGFSQARQQIGLDWLITQGALYIIGAAIYAARVPECLHPGKYDIIGHSHQIFHVLVVLAAGAHLTGLLGAFDYRHSLATQC*


> Trichophyton equinum (PQRB) NCBI Genome

MGGGRRRARIAVETLESRYNEVLATKETLEQKAQAMRLMEDFLSQLEARVHSVRDRGLYGAIDEGLRAVDFSITHARVMIDEGIERAVHAKIALRESIDRAIALAKEKRLIHYSDLPQPWRVNPHIRKGYRFTASKIECLTSVFSFSNELVNIWSHLIGLIIVLAVAFYFYPLSPNFHLSTKTDVTIAFIFFIAACKCLVCSTLWHTMNSIANQPLMERFACVDYTGISLLVAASIVTTEYTAFYCEPYSRWIYILMTSTLGIAGVILPWHPRFNGPHMAWARVAFYVTLALTGFAPIVQLSLTRGLQWSLYFYAPVVKSILVYFCGACIYASQIPERWHPGFFDYVGGSHNIWHVAVLGGILFHYLAMQDLFTGAFLRAKGECPCLTS*


> Trichophyton equinum (PQRA4A) NCBI Genome

MPQQKLADSALTPPRLDSPPIQPLERLLKFDETPSWFEGNQFILTGYRHESRSAIRCLHSWTYLHNESCNIYSHLLPAVAYAALHWCLVNIYLPSRYNTLSKGDGLILSLFLSTVVLCLGASSLYHTFLNHSAPIAKRWLLCDYMGIITLIQGCFISGIYFGFYCEPYLQRVYWTMVCIVVLGSLTATILLSSKFQDQKWRGFRVAVFVCTGLSAFAPITHALFLYGLKRSMNVGLPYYLTEGAIIAFAAFIYEVRQIPERWFPGKFDIWGHSHTIFHSMVALGMCVHFVGLLEALEYTYYNSQCTLR*


> Trichophyton equinum (PQRA4C) NCBI Genome

MTVLPALRSRGFVASRPPRVDLDETPPLLPRKNQEHGALTLSNKEVPHWLGESNYILTGYRVPCNSTARCFYSWFYLHNETVNIYTHLIPAIGFAAAEVFVFRHFETLYPEAPVTDKAVFSLFLLTAIMCMSCSTLFHTFMSHSEKVAKACLRADYMGIAGLIFGDIISGTYVVFYSDTALWAIYWTFVFSSLTCMILFHPKFEGEEYRTFRAWTFICTGLSSLAPLMHAIILYGLEEMMEHGGLPYYLLEGLLHIIGVAFYVVSTRIPESLRPGKFDIWFNSHQIFHVLVVLATISQVIGIWSAYDYKYHTEISLLHRPRSLAG*


Dikarya; Ascomycota; Saccharomyceta; Pezizomycotina; Leotiomyceta; Eurotiomycetes; Eurotiomycetidae; Onygenales; Arthrodermataceae; mitosporic Arthrodermataceae; Trichophyton; Trichophyton tonsurans
> Trichophyton tonsurans (PQRA1) NCBI Genome

MSLLQRRAVTTAAAAAVYRREEAETSQQQQQQQQTEAETEVEVLEQESWTATVHWDALPRWLQDNHHIHTGYRPASASFLRSFHSLTYVHNETVNIYTHLLPALLTLPTSFVLYRALSPRYHTATPADIVVFSCFFAGAAFCLGMSALYHTISNHSPWVAYIGNACDYLGIIGLITGSFIPSIYYGFYCTPQLQRLYWGMIVVLGAGCAAVATIPRFRKPALRPFRAAMFVALGLSAVFPVTHGVVVLGFSQARQQIGLDWLITQGALYIIGAAIYAARVPECLHPGKYDIIGHSHQIFHVLVVLAAGAHLTGLLGAFDYRHSLATQC*


> Trichophyton tonsurans (PQRB) NCBI Genome

MGGGRRRARIAVETLESRYNEVLATKETLEQKAQASMRLMEDFLSQLEARVHSVRDRGLYGAIDEGLRAVDSSITHARVMIDEGIERAVHAKIALRESIDRAIALAKEKRLIHYSDLPQPWRVNPHIRKGYRFTASKIECLTSVFSFSNELVNIWSHLIGLIIVLAVAFYFYPLSPNFHLSTKTDVTIAFIFFIAACKCLVCSTLWHTMNSIANQPLMERFACVDYTGISLLVAASIVTTEYTAFYCEPYSRWIYILMTSTLGIAGVILPWHPRFNGPHMAWARVAFYVTLALTGFAPIVQLSLTRGLQWSLYFYAPVVKSILVYFCGACIYASQIPERWHPGFFDYVGGSHNIWHVAVLGGILFHYLAMQDLFTGAFLRAKGECPCLTS*


> Trichophyton tonsurans (PQRA4A) NCBI Genome

MPQQKLADSVLTPPRLDSPPIQPLERLLKFDETPSWFEGNQFILTGYRHESRSAIRCLHSWTYLHNESCNIYSHLLPAVAYAALHWCLVNIYLPSRYNTLSKGDGLILSLFLSSVVLCLGASSLYHTFLNHSAPIAKRWLLCDYMGIITLIQGCFISGIYFGFYCEPYLQRVYWTMVCIVVLGSLTATILLSSKFQDQKWRGFRVAVFVCTGLSAFAPITHALFLYGLKRSMNVGLPHYLTEGAIIAFAAFIYEVRQIPERWFPGKFDIWGHSHTIFHSMVALGMCVHFVGLLEALEYTYYNSQCTLR*


> Trichophyton tonsurans (PQRA4C) NCBI Genome

MTVLPALRSRGFVASRPPRVDLDETPPLLPRKNQEHGALTLSNKEVPHWLGESNYILTGYRVPCNSTARCFYSWFYLHNETVNIYTHLIPAIGFAAAEVFVFRHFETLYPEAPVTDKAVFSLFLLTAIMCMSCSTLFHTFMSHSEKVAKACLRADYMGIAGLIFGDIISGTYVVFYSDTALWAIYWTFVFSSLTCMILFHPKFEGEEYRTFRAWTFICTGLSSLAPLMHAIILYGLEEMMEHGGLPYYLLEGLLHIIGVAFYVVSTRIPESLRPGKFDIWFNSHQIFHVLVVLATISQVIGIWSAYDYKYHTEISLLHRPRSLAG*


Dikarya; Ascomycota; Saccharomyceta; Pezizomycotina; Leotiomyceta; Eurotiomycetes; Eurotiomycetidae; Onygenales; Arthrodermataceae; mitosporic Arthrodermataceae; Trichophyton; Trichophyton rubrum
> Trichophyton rubrum (PQRA1) NCBI Genome

MSLLQRRAVTAAAATAVYRREEKETSQQQQQIKTETEAEAEVLEQESWTATVHWDALPRWLQDNHHIHTGYRPASASFLRSFHSLTYVHNETVNIYTHLLPALLTLPTSFVLYRALSPRYHTATPADIVVFSCFFAGAAFCLGMSALYHTISNHSPWVAYIGNACDYLGIIGLITGSFIPSIYYGFYCTPQLQRLYWGMIVVLGAGCAAVATIPRFRKPALRPFRAAMFVALGLSAVFPVTHGVVVLGFSQARLQIGLDWLITQGALYIIGAAIYAARVPECLHPGKYDIIGHSHQIFHVLVVLAAGAHLTGLLGAFDYRHSLATQC*


> Trichophyton rubrum (PQRB) NCBI Genome

MGGGRRRARIAVETLESRYNEVLATKETLEQKAQASMRLMEDFLSQLEARVHSVRDRGLYGAIDEGLRAVDSSITHARVMLDEGIERAVHAKIALRESIDRAIALAKEKRLIHYSDLPQPWRVNPHIRKGYRFTASKIECLTSVFSFSNELVNIWSHLIGLIIVLAVAFYFYPLSPNFHLSTKTDVTIAFIFFIAACKCLVCSTLWHTMNSIANQPLMERFACVDYTGISLLVAASIVTTEYTAFYCEPYSRWIYILMTSTLGIAGVILPWHPRFNGPHMAWARVAFYVTLALTGFAPIVQLSLTRGLQWSLYFYAPVVKSILVYFCGACIYASQIPERWHPGFFDYVGGSHNIWHVAVLGGILFHYLAMQDLFAGAFLRAKGECPCLTS*


> Trichophyton rubrum (PQRA4A) NCBI Genome

MPQQKLADSALTPPRLDSPPIQPPERLLKFDETPSWFEGNQFILTGYRHESRSAIRCLHSWTYLHNESCNIYSHLLPAVAYVALHWYLVNIYLPSFLNHSAPIAKRWLLCDYMGIITLIQGCFISGIYFGFYCEPYLQRLYWTMVCIVVLGSLTATILLSSKFQDQKWRGFRVAVFVCTGLSAFAPITHALFLYGLKRSMNVGLPYYLTEGAMIAFAAFIYEVRQIPERWFPGKFDIWGHSHTIFHSMVALGMCIHYVGLLEALEYTYYNSQCTVR*


> Trichophyton rubrum (PQRA4C) NCBI Genome

MTVLPALRSRGFVASRPPRVDLDETPPLLPRKSQEHGALTLSNKEVPHWLGESNYILTGYRVPCNSTARCFYSWFYTHNETVNIYTHLIPAIGFAAAEGFVFRHFEALYPEAPVADKVVFSLFLLTAIMCMSCSTLFHTFMSHSEKVAKACLRADYMGIAGLIFGDIISGTYVVFYSDTALWAIYWTTVFSSLTCMILFHPKFEGEEYRTFRAWTFICTGLSSLAPLMHAIILYGLEEMMEHGGLPYYLLEGLLHIIGVAFYVVSTRIPESLRPGKFDIWFNSHQIFHILVVLATISQVIGIWSAYDHKYYTEISLLH*


Dikarya; Ascomycota; Saccharomyceta; Pezizomycotina; Leotiomyceta; Eurotiomycetes; Eurotiomycetidae; Onygenales; Arthrodermataceae; mitosporic Arthrodermataceae; Trichophyton; Trichophyton verrucosum
> Trichophyton verrucosum HKI 0517 (PQRA1) NCBI Genome

MSLLQRRAVTTAAAAAVYKKEEAETSQHQQQTKTETEAEVLEQESWTATVHWDALPRWLQDNHHIHTGYRPASASFLRSFHSLTYVHNETVNIYTHLLPALLTLPTSFVLYQALSPRYHTATPADIVVFSCFFAGAAFCLGMSALYHTISNHSPWAAYIGNACDYLGIIGLITGSFIPSIYYGFYCTPQLQRLYWGMIVVLGAGCAAVATIPRFRKPALRPFRAAMFVALGLSAVFPVTHGVVVLGFSQARQQIGLDWLITQGALYIIGAAIYAARVPECLHPGKYDIIGHSHQIFHVLVVLAASAHLTGLLAAFDYRHSLATQC*


> Trichophyton verrucosum HKI 0517 (PQRB) NCBI:EFE43025.1

MHDLAGLQPPHLPRGQFAALFTHLHPGQRPFLNDFPRSPSSEYFLSILEQRSVASLSGSRVPKDDNNLISPKPSPLSPLNKNRDLNTTTSRNTYKQPSQRRTEGLDIYLLGIISKGLSRPWEMACTTPSITIESRTGTPSSTASGYLSPANELTGLLKDRRRRHSFHTSRRLSCDYDEDAIYLKVDLFLAELERRLQWLEDYRQSHILQIDSGLRRAYGALVAVRDSCSHASGELMGGGRRRARIAVETLESRYNEVLATKETLEQKAQASMRLMEDFLSQLEARVHSVRDRGLYGAIDEGLRAVDSSITHARVMLDEGIERAVHAKIALRESIDRAIALAKEKRLIHYSDLPQPWRVNPHIRKGYRFTASKIECLTSVFSFSNELVNIWSHLIGLIIVLAVAFYFYPLSPNFHLSTKTDVTIAFIFFIAACKCLVCSTLWHTMNSIANQPLMERFACVDYTGISLLVAASIVTTEYTAFYCEPYSRWIYILMTSTLGIAGVILPWHPRFNGPHMAWARVAFYVTLALTGFAPIVQLSLTRGLQWSLYFYAPVVKSILVYFCGACIYASQIPERWHPGFFDYVGGSHNIWHVAVLGGILFHYLAMQDLFAGAFLRAKGECPCLTS*


> Trichophyton verrucosum HKI 0517 (PQRA4A) NCBI Genome

MPQQKLADSALTPPRLDSPPIQPLGRLLKFDETPSWFEGNQFILTGYRHESRSAIRCLHSWTYLHNESCNIYSHLLPAVAYIALHWYLVNIYLPSRYNTLTKGDGLILSLFLSTVVLCLGASSLYHTFLNHSAPIARRWLLCDYMGIITLIQGCFISGIYFGFYCEPYLQRLYWTMVCIVVLGSLTATILLSSKFQDRKWRGFRVAVFVCTGLSAFAPITHALFLHGLKRSMNVGLPYYLTEGALIAFAAFIYEVRQIPERWFPGKFDIWGHSHTIFHSMVALGMCIHFVGLLEALEYTYYNSQCTVR*


> Trichophyton verrucosum HKI 0517 (PQRA4C) NCBI Genome

MTVLPALRSRGFVASRPPRVDLDETPPLLPRKSQEHGALTLSNKEVPHWLGESNYILTGYRVPCNSTARCFYSWFYLHNETVNIYTHLIPAIGFAAAEVFVFRHFETLYPEAPVADKAVFSLFLLTAIMCMSCSTLFHTFMSHSEKVAKACLRADYMGIAGLIFGDIISGTYVVFYSDTVLWAIYWTSVFSSLTCMILFHPKFEGEEYRTFRAWTFICTGLSSLAPLMHANILYGLEEMMEHGGLPYYLLEGLLHIIGVVFFVVSRIPESLRPGKFDIWFNSHQIFHVLVVLATISQVIGIWSAYDYKYHTEISLLHRPQSLAG*


Dikarya; Ascomycota; Saccharomyceta; Pezizomycotina; Leotiomyceta; Eurotiomycetes; Eurotiomycetidae; Onygenales; Ajellomycetaceae; Ajellomyces; Ajellomyces capsulatus
> Ajellomyces capsulatus (PQRA1) NCBI:EEH04917.1 and EDN02253.1

MFVSKRRKSNASSQENHRHHSRVTIDKFVTEKATDTAAKIAYKARRTIHWDDLEHWQRDNHLIHTGYRPASRSFMVSFHSLGYVHNETVNIYTHLLPAISSVPFAFYLYKAISARYDSATHGDVLVFSCFFAGTAFCLGMSSIYHTISNHSPAVARIGNAMDYIGIVGLITGSFIPSVYYGFYCMSRFKKIYWTMILLIGAGCTVISIMPRFRTPPWRPFRAGMYVSMGLSAVFPVLHGVSIFGVELMLKQIGLFWLVLQGALYIIGAAVYAARVPERWYPGGFDVLGSSHQIFHVLVVLAAISHLTGLLQAFDYRHSGLALSCL*


> Ajellomyces capsulatus (PQRB) NCBI:XP_001537507

MACTAPSVTFKSYAYLDPVSNASGLATPDERSGFIRNRRRRHSFHTNRRLSCDHDADAIFLRVELFLAEMERRLQWLEEYRQSHMTHIDARLRRGYAALVSVRDSCSHASGELMGGGKRRAKILVETLEERYKEALATKETLEQKAQASMRLMENFLGELEAGAQAVRDRGLYGTLDDGWRAVEPGLTHAREVMDESVERAREALQKSIERAIQLANEKRLIQYSDLPYPWRVNPHILQGYRFTTSKIECVTSAFTFSNELFNIWSHLIGLLIVLAVAFYFYPSNPNFSLSTKTDIAIAAIFFIAACKCLVCSTLWHTMNSIASQPLMERFACVDYTGISLLVAASIVTTEYTAFYCEPTSRWIYIITTSTLGIAGVILPWHPTFNRADMAWARVAFYVTLAATGFAPIAQLSLTRSLGWCLYFYAPLLKSLGVYLLGAMIYAMQIPERWLPGFFDYLGGSHNIWHVAVLGGILFHYGAMQDLFTGAFVRAEGECPSLT*


> Ajellomyces capsulatus (PQRA4A) NCBI:EEH10139

MAPYQRLLSARSDGMWDQSTATNTFRPVAAVEHPRTKYRLLTATEVPPWYAHNSFLLTGYRPVTRSTRLCLESLRCLHNETVNIYSHLVPAGIAVISNGVFHLYFRNRYPTASCADQLAFHVYLCTSILCFGISSIYHTLLCHSEDYVKLWALLDYVAIIFQTLGSFISGIYVSFYCEPGLQKLYWTMIGVLGLLTATVVVSPRFQSSKWRKLRLSTFVATGFSALAPMIHASIIFPYAQWNQQAGLGYYLLEGLSIITGTIFYATRFPESWMPERFDIWGASHQIFHIFVVLGAVIHVWAILSVFDYVHENPRCLV*


Dikarya; Ascomycota; Saccharomyceta; Pezizomycotina; Leotiomyceta; Eurotiomycetes; Eurotiomycetidae; Onygenales; Ajellomycetaceae; Ajellomyces; Ajellomyces dermatitidis
> Ajellomyces dermatitidis (PQRA1) NCBI:EEQ83856

MSLYQRAKKNSSQREGHGHLSRFSANESVVEKATDTATEIASKIRRTVHWDELESWQRDNHLIHTGYRPASGSFTVSFRSLGYVHNETVNIYTHLLPALSAIPLAFYLYKAISTRYDSATHGDVLAFGCFFAGAAFCLGMSSIYHTISNHSPAVARIGNAMDYIGIVALITGSFIPSVYYGFYCVPKFMKMYWTMILLIGAGCTIVSITPRFRTPAWRPFRAGMFISMGLSAVFPVLHGVSIFGVELMLKQIGLFWLVLQGALYIIGAIIYAARVPELWYPGGFDILGSSHQIFHMFVVMAAVAHLTGLLQAFDYRHSGLALPCL*


> Ajellomyces dermatitidis (PQRB) NCBI:EEQ72378

MERRLQWLEEYRQSHITHIDARLKRGYAALVSVRDSCSHASGELMGSGKRRAKILVETLEDRYKEALATKETLEQKAQASMRLMENFLGELEVSAQAVRDRGLYGTLDDGWRAVEPGLTHAREVMDESVERAREALQKNIERAIHLANERRLIQYSDLPHPWRVNPYILQGYRFTTSKIECVTSVFTFSNELFNIWSHFIGLLVVLAVAFYFYPANPNFTLSTKTDITVAAIFFVAACKCLVCSTLWHTMNSIASQPLMERFACVDYTGISLLVAASIVTTEYTAFYCEPVSRWIYIVTTSSLGVAGVILPWHPTFNRADMAWARVSFYVTLAATGFAPMAQLSLTRSLGWSLYFYAPLLKSLAVYLLGAMIYALQIPERWLPGFFDYIGGSHNIWHVAVLGGILFHYTAMQDLFTGAFVRAEGECPSLT*


> Ajellomyces dermatitidis (PQRA4A) NCBI:EEQ91982.1 and EEQ75990.1

MTLYQRLSPARSEGDRTGSSKGTTPLKQQNPAQKPQLLRASELPSWYAHNTYLLTGYRPITGSVRLCIDSLRTLHNETVNIYSHLLPAAIALASNAILHLYFRARYPDEAVLALQHRLAVHIYLTTSVLCFGISSAYHTLLCHSEEYAGLWGRMDYVAILLQTIGSFVSGIYVTFDCEPGLRRVYWTMVGALGTLSAIIVVSPKFQSSRWRMLRLATFVATGLSGLLPIIHAACIYPYAEWSPRAGLGYYLLEGLALIVGTLFYATHFPESWTPEKFDIWGASHQIFHLFVVLSAGIHIWTLFSVLDWIYANPRCVI*


Dikarya; Ascomycota; Saccharomyceta; Pezizomycotina; Leotiomyceta; Eurotiomycetes; Eurotiomycetidae; Onygenales; Onygenaceae; Uncinocarpus; Uncinocarpus reesei
> Uncinocarpus reesei (PQRA1) NCBI:EEP82509

MSVVQRRQVSVQTEVEEATDGTTNTARIVKTTIRTIHWDDLPHWLRDNQHIHAGYRPASKSFVKSFKSLAYIHNETVNIYSHLLPALLSVPLSIAIYRAISPRYETASHADITAFGCFFAGAAFCLGMSSLYHTISNHSPLVAYIGNACDYVGIVGLIAGSFVPSVYYGFYCMPNLQVLYWSMICLLGLGCATVSTIPRFRTPAWRPFRATMFVSMGLSAVFPVIHGLVIFGFAQMRRQIGLWWLLLQGFLYILGAAIYAARVPERLWPGKFDIVGHSHQVFHLLVVLAACAHLTGLLEAFDYRHSGVAPACAG*


> Uncinocarpus reesei (PQRB) NCBI:EEP77426

MERRLQWLEEYRQFHMVDIDSGLKRAYAALETVRDKCCHASGELMGGGKRRAKIVVETLEEQYSHALATKETLDQKAQAGMRLMENFLSELEASVHAVKDRGIYGAIDDGWRAVDSGLHHARERARHAQVALRENIERAIQLAQEKRLITYADLPHPWRVNPHILDGYRFTTSKIECVTSVFTFSNELVNIWSHLIGLIIVLAVAFYFYPLSPNFTLSTKADVAIAAIFFIAACKCLVCSTVWHTMNGIASQSLMERFACVDYTGISFLVAASIVTTEYTAFYCEPLSRWIYILMTSSLGIAGIILPWHPTFNRADMAWARVAFYVTLALTGFAPMVQLSITRGLAWPFYFYSPIMKSLLVYLTGACIYASQIPERWRPGFFDYIGGSHNIWHLAVLGGILFHYHAMQDLFAGAFVRAQGECPVLTY*


> Uncinocarpus reesei (PQRA4A)

MPRSPTPEALDPKSPKRLLNFEETPLWYEANEFILSGYRSQSNSAISSFHSWTYLHNESCNIYSHLIPMVISILAQPALQQYLSTRNNLTAMSLVDRAMLSFHLFTVTACLGTSTVYHTLMNHSPGVANQFLACDYMGIVTLILGDFISGIYFGFYCELSPKLIYWSMVALGSLTAMILLKPRFQGPEWRTFRLCIFIGTALSAFAPIAHASFLFGSDIWKLGVPYYLLEGVILVTACYIYEVRRQIPERWRPGQFDIYGHSHTIFHILVVVATAAHFKGLLSAFEYDCNLGKC*


> Uncinocarpus reesei (PQRA4C) NCBI Genome

MGESISVASFPRLRSAVPAIRPLEIEQESLRVEPCEPARKPIATVNDRPKLLSFDQLPPWLQDNEYILSGYRPPLQSVTECVASLTYLHNETANIYTHMIPALFVAAGEVLLFYSLPSVLSKATETDYVVLRSLVAALCAFGFSTGYHTLMSHSNVSELWLRIDYIGIVGLILGNILSGTYMVFYCLPKLIWLYWGTVNPSLSCMIILNPKFQGRNWRHFRTGTFVCTGLSSLAPLAHAIRTFGLSGMLKRSGLPYYLLEGLLHLIGVFFYTASDMKTRIPESLRPGHFDLWFSSHQIFHVLVVLATVAQIFGVWHAFDYNY*


Dikarya; Ascomycota; Saccharomyceta; Pezizomycotina; Leotiomyceta; Eurotiomycetes; Eurotiomycetidae; Onygenales; Ascosphaeraceae; Ascosphaera; Ascosphaera apis
> Ascosphaera apis (PQRA1) NCBI Genome

MHNVRRLVLWDDLPLWQRDNQYIRSGYRPMSNSVKGSFRSLLYLHNETVNIYSHLLPSLLIVPSSFIIINALRSRYESASQADVIAFSCFFIGAAVCLALSATYHTLSNHSPRVARIGNALDYLGIVGLITGSFVPSVYYAFYCHPHLQMMYWVMICSIGVGCATVSVFNRFRSPEWRPFRAAMFVSMGLSAIFPVIHGLLIFGIGQMKLQIGLHWLLLQGFLYILGAYLYAIRVPEKWYPGRFDLLGSSHQIFHVLVVLAAMSHLTGLFQAFDYRHSGEAASCLV*

1   2   3   4   5   6   7   8   9   10


Verilənlər bazası müəlliflik hüququ ilə müdafiə olunur ©azrefs.org 2016
rəhbərliyinə müraciət

    Ana səhifə