If no accession number is given or only a partial protein sequence is found in the database then the protein sequence was derived from genomic sequence. Grey shading indicates genomes that are complete according to ncbi




Yüklə 371.95 Kb.
səhifə4/10
tarix23.04.2016
ölçüsü371.95 Kb.
1   2   3   4   5   6   7   8   9   10

> Mycosphaerella pini (PQRA1) JGI Genome

MRDNHYIHSGYRPASNSYHKSFSSVTHLHNETVNIWSHLLGAIAAATTAIILYSTMRPRFNLATSEDVMVFACFFLGAVVCLGMSATYHTISNHSEAVAKFGNRLDYIGIVVLIWGSFVPSIYYGFGTEPGLIRVYWSMITTIGAGTLVVIMHPRFRSPEWRPFRASMFVMMGLSAIFPVLHGVQMYGLQQMEQQIGLSWLVGQGALYIAGATIYAARVPERWRPGSFDIWGSSHQIFHVLVVLAAAAHLLGLMKAFDYEHRLRSGIAGWKKSG*


> Mycosphaerella pini (PQRA3B) JGI Genome

MSFQQIVPLSLAAASEKESWPKSNNIESSYGPPTSNSLLSSLTSLGHLNNQTVNTYSHLLGAVGFLALPFYFYWNVLPTQPTARTADLVVVTVYCLGVATCFVFSAIFHTLYNHSCVVARYWNKLDYLGILVLMWGAGVPTIYYGFVCNPHWQQLYWTTTTVTAVGCTILTLNPVFGLPAFRGWRAALYAGFGLSSVIFVVHGLAAYGWDVQKSRMSLVWMGWMGTANLVGAVIYTARIPERWAPVRFDIIGASHQILHVAVLVASSIHFFGLMAAFTAIHSLSNPCSSS*


> Mycosphaerella pini (PQRB) JGI Genome

MSTYTTMTTCTKTFTDTREEPTVGASSGAEIDHEIERARKRRRHSSYNPRSWSLERENAQIVVENFLNDLGKRLEMLETYGSLKFDEGVKSVHDTLHHVHERCAQVSDDIIDAGRRRRKVFVETLESHYRDALVRKDTLEQKVQEGVKVMEANLVALEQRAYKMRERGLTATAHELMDSGIAYMESTATTAAEIVHEGADAARRAKDKMKLKVEIALAHARKHGLVTYDMLPEPWRVNPHILSGYRFSETKLDCVRSCFTMSNEFFNIWSHAIGLVIVLAIAFYFYPNTPAFTSATYFDIVIAGCFFFAACKCLVCSCMWHAMSSISDQNLMERFACVDYTGISLLVAASIMTTEYTAFYCEPWSRWTWISMTFALGIAGVILPWHPTFNRADMAWARVGFYVTLATTGFLPVFQLTYERGLGETFYFYAPIVKSIAVYLGGAVMYAAKIPERFLPGWFDYAGGSHNIWHLAVLGGILFHYSAMQSFFGEAFRRANVGCSTY*


Dikarya; Ascomycota; Saccharomyceta; Pezizomycotina; Leotiomyceta; Dothideomyceta; Dothideomycetes; Dothideomycetidae; Capnodiales; Mycosphaerellaceae; Mycosphaerella; Mycosphaerella populorum (Septoria musiva)
> Mycosphaerella populorum (PQRA1) JGI Genome

MDKKPASVVRCEKEPKDGDTVFHKAEHKIESALTVAWHQIQDWQQDNHYIISGYRPASNSYAKSAASIGYLHNESVNIWTHLLGAIAAVLSASGILFAVKPRFDQATSQDVLVFSCFFAGAFACLGMSATFHTISNHSAAVQKFGNRLDYIGIIFLIWGSFIPSIYYGFAADPKLIQVYWSMISTIGAVTFVVVMHPKFRSSAWRPFRAIMFVMMGLSAVIPVLHGLKLYGLEQMERQIGLTWLVSMGILYITGAVIYASRVPERWNPGKYDLFGSSHQIFHVLVVLAAAAHLVGLLKAFDYEHSSRIEALFAHTAVRH*


> Mycosphaerella populorum (PQRA3B) JGI Genome

MASSRKADKPTSQPDPPTEELSKGSQRHPWRLLFWHEIPSWQKDNEFILSGYRPTSHSIWKSILSLSYLNNQTINAYSHLVGSAIFLALPWYFYEKIYNNTTVTPYGQLVDLVVVSTYCLGVAVCFAFSATFHILWNHSSECSRFCNKLDYLGILVLMWGAGIPTIYYGFLCNPTLRWTYWAMTTSTALGCTYLTLSPHFASPAFRHWRAGFYAGFGLSSIIFVGHGLLLYGWEVQRSRMSLVYMGWMATANLVGAAIYAARIPERWVPYRFDTFGASHQIFHVAVMLAAWIHFDGLATAFRLIRVVPDRCSSST*


> Mycosphaerella populorum (PQRB) JGI Genome

MTQTTYCTARSGTATITESCEEPTLGATSGAQFDTELERSRKRRRHSSYNPRSWSSERDNVQIVIDDFLSDLGKRLAMVEEYGHLKFDAGVTTVFDTLTAIHQRCMKEYDGMRESGRRRHKAFVDALEAQYKDALAKRETLEAKVQEGVNMLEEHLAALEQRAYHLREKGAMATAHQMLDSGIAYMDETAIKASHLMLEGADAARRAKEHMKMKIEVALGHARKHGVITYDMLPEPWRVNPYILSGYRFSENKLQCVTSCFTLSNEFVNIWSHAIGLIVVLAIAFWIYPSTPAFIDATAFDIVIAGAFFFAACKCLVCSTMWHAMSSISNQTLMERFACVDYTGISLLVAASIMTTEYTAFYCEPVSRWVYMSLTFALGIGGIILPWQPTFNRADMAWARVGFYVSLALTGFLPMAQLTVERGWLATLYFYAPILKSVLVYFSGAVLYAAKIPERFLPGWFDYLGGSHNIWHFAVLGGILFHYTAMQSFFGDAFRRANAPAGCSVY*


Dikarya; Ascomycota; Saccharomyceta; Pezizomycotina; Leotiomyceta; Dothideomyceta; Dothideomycetes; Dothideomycetidae; Capnodiales; Teratosphaeriaceae; mitosporic Teratosphaeriaceae; Baudoinia; Baudoinia compniacensis
> Baudoinia compniacensis (PQRA) JGI Genome

MDDKVDLVTKAEIKTQEALTVLWNDLPIWLQDNHYIHSGYRPQSNSYMKSAASLGYLHNESVNVWTHLLGAIIAAIAGTVLWTAIKPRFNMATNDDVKVFGCYFLGAVLCLGMSATYHTICNHSPAVAKFGNRLDYIGIILLIWGSFIPSIYYGFGSEPGLVRLYWAMITSIGVGTLAVVTLPRFRSPELRPVRAAMFVAMGLSAVFPVIHGAWRYGAAQMERQMGLSWVISQGVLYIAGAVIYAARIPERFKPGAFDLFGHSHQIFHVLVLLAAATHLVGLLKAFDYEHSHRSGLFDAYSSVRDVGRK*


> Baudoinia compniacensis (PQRB) JGI Genome

MSAYTTISGFSSNCTTVITETHEEPTLGASSGADFDIDIQRARKRRRHSSYHARTWSLDRDNVQLLVDRFLAELGQRLALVEDYGHFKIDEGMTIALDTLRDVNESCMQVGGDLVDAGRRRAHILVDTVDAHYKGALATKESLEQRIRDGVKICEGILSDFEKAAYELRPAGFAEILDSGIAYADTAAARAAGMVSEGAEAARRAQAKLKLKVEEAVARARNYGLLTYEQLPEPWKGNPHIISGYRFSESTAECIRSCFSVSNETVNIWSHAIGLLVVLALAFYVYPTTPAFTAATKFDIAIAGCFFFAACKCLICSTMWHTMSSHSNQTIMERFACVDYTGISLLVATSIMTTEYTAFYCEPWSRWVYLTTTVVLGAAGTVLPWNPFFNRADMNWLRVAFYVSLAATGFFPVLQLTLERGWNATAYFYAPISKSILVYLGGALLYAARMPERFLPGWFDYVGASHNIWHFAVLGGILFHYTAMQRFFGEAFKRAEIECSVY*


Dikarya; Ascomycota; Saccharomyceta; Pezizomycotina; Leotiomyceta; Eurotiomycetes; Eurotiomycetidae; Eurotiales; Trichocomaceae; Neosartorya; Aspergillus fumigatus
> Aspergillus fumigatus (PQRA1) NCBI:XP_754562

MSARQRRPAESYENTSNSSQPAAIASAVLEKPPKVMKKLVHWDDLPHWQRDNHHIHTGYRPASFSFLVSFQSLTYLHNETVNIYTHLLPSLLSIPAAYLLYQELVPRYGTATRDDIIAFSCFFAGAAFCLGMSATYHTISNHSPLVARIGNTFDYIGIIGLIVGSFVPSIYYGFYCVPALQRLYWTMICAIGLGCIIVSILPKFRTPQWRPFRAAMFVGMGLSAVFPVLHGLQMFGFDQMTRQIGLGWLLLQGFLYILGATIYAARVPERLRPGKFDILGSSHQIFHVLVVCAAVAHLTGLLKAFDYRHSGVAGSCLLEVN*
> Aspergillus fumigatus (PQRB) NCBI:XP_750609

MACTTQSMTLESYPDATSTSFATTPSEGTGLLRDRRRRHSFHTARKLSCDYDGDAIFLRVELFLAELERRMHWIEQYRKSHMVHIDSSLRRAYATLEAVRDSCSYASGELMGGGKKRAKILVETLEDRYNDALATKETLEQKAQAGVRLMESFLVELESRAHAVRDRGIYGALDDGWKAVDSKLVHAREVVDEGIEQARRAKDSLRESINRAILLAQEQRLITYADLPHPWRINPHILQGYRFSSSKVECLMSVFSVCNETVNIWSHLIGLFIVLSVAFYFYPLNPNFHLSTKTDVAIAAVFFFAACKCLVCSTLWHTMNSIANQPLMERFACVDYTGISLLVAASIVTTEYTAFYCEPVSRWTYILLTMSLGIGGVILPWHPTFNRNDLAWARVAFYVTLALTGFAPLFQLTYTRGFVWCLYFYAPVVKSILVYFAGACIYASQIPERWRPGLFDYFGGSHNIWHIAVLGGILFHYCAMQDLFANAFVRAKGECPSLTA*
> Aspergillus fumigatus (PQRA5) NCBI:partial XP_746466.1

MTTVRLAFSYLLSPSSPKVVGNPPVKVSESLKKQRVFHASQIPAWMQWDPYILHGYRGQLDSYGQCFWSLFYLHNESVNTWSHIIPGMYFLTLLLAIDYWIIQLPLEVPVMDILAIQTYVAGTAGCLIFSAAFHATNAHSPEVAHAFLKLDYLGIVMTITTTCISVTYFALYSYPILQVTYIFLTVLCAATIFWVALDPRMDGARAGPWRSVFAAVFFLLATSGLAPIFHVIWAEASYGLIRIPLDSLTVTCSSYAVGTAVYVTRFPERFWPARFDLIGASHQIFHILVAFGQIVHLFGLREVLLRIHMGMCAV*
> Aspergillus fumigatus (PQRA4A) NCBI:XP_747879.1

MVFNGLLRFRIIRSKQVKEIALGGGHDQSQPVEKQTLLTIKQLPPWYDPNPFILSGYRPETRSYYRCFASWLYCHNETGNIYSHLIPGILLLSSQGILYEYIRTKHENLSNFDWSIVSLQLVTASICLLTSTTYHTLLNHSAAVAHRWLQLDYIGIIALILGNFISGLHFGFYCNPQLKHFYWSLILAFSSATAVALLSPQFRGLEWRSFRLASFVCTGLSAFAPIGHACMLWGVPYLWKIGVKYYLLEGVCLIIGCYFWEVRVPESLYPGAFDIWGHSHTIWHVFVTFSIGAHVMGLLHGLEYSYSQAECR*
Dikarya; Ascomycota; Saccharomyceta; Pezizomycotina; Leotiomyceta; Eurotiomycetes; Eurotiomycetidae; Eurotiales; Trichocomaceae; Neosartorya; Neosartorya fischeri
> Neosartorya fischeri (PQRA1) NCBI:XP_001263402

MSARQRRPAESYQNASNSSQPAAIASAVLEKPPEVVKKLLHWDDLPHWQRDNHHIHTGYRPASFSFLVSFQSLTYLHNETVNIYTHLLPSLLSIPAAYLLYQELVPRYGTATRDDIIAFSCFFAGAAFCLGMSATYHTISNHSPLVARIGNTFDYVGIVGLIVGSFVPSVYYGFYCVPALQRLYWTMICTIGLGCVIVSVLPKFRTPQWRPFRAAMFVGMGLSAVFPVLHGLQMFGFDQMTRQIGLGWLLLQGFLYILGATIYAARVPERLRPGKFDILGSSHQIFHVLVVCAAVAHLTGLLKAFDYRHSGIAGSCLLETN*


> Neosartorya fischeri (PQRB) NCBI:XP_001257832

MHWIEQYRKSHMVQIDSSLRRAYATLEAVRDSCSYASGELMGGGKKRAKILVETLEDRYNDALATKETLEQKAQAGVRLMESFLVELESRAHAVRDRGIYGALDDGWKAVDSKLVHAREVVDEGIEQARRAKDSLRESINRAILLAQEQRLITYADLPHPWRINPHILQGYRFSSSKVECLMSVFSFCNETVNIWSHLIGLFIVLSVAFYFYPLNPNFHLSTKTDVAIAAVFFFAACKCLVCSTLWHTMNSIANQPLMERFACVDYTGISLLVAASIVTTEYTAFYCEPVSRWTYILLTMSLGIGGVILPWHPTFNRNDLAWARVAFYVTLALTGFAPLFQLTYTRGFAWCLYFYAPVVKSILVYFAGACIYASQVPERWRPGLFDYFGGSHNIWHLAVLGGILFHYCAMQDLFANAFVRAKGECPSLTA*


> Neosartorya fischeri (PQRA2) NCBI:partial EAW22053.1

MSTTNDPTNQPKAKARTVTWQEISKWQFDNKYILSGYRPAKADYLEIFTSLTFLHNESCNVYTHLIGALLLPLVATTFQRYLAEPQFLNVSFMDYAIFGIYFWCAEICLVLSALYHLMQPHSHQVEQFWHGMDLLGIVIVTVGTFSSGIYYVFFCETSLQKLHWAIVSVLTTGTVTGVLISNPLLKTPRWRKVKVCAFVIFGASSFIPLLHGVQRYGLEYMLQYSGMKWYLLELTFWHWSRSICGMSAHLPRVPERLAPGKFDIWGSSHQIFHIAILCAMYTHQTALLQGFTTCHTLDVCQLQGVY*


> Neosartorya fischeri (PQRA4A) NCBI:EAW15481.1

MVFNGLLRFRIIRSKEVMEIALSGGHDQSQLVKKQTLLTIKQLPPWYDPNPFILSGYRPESRSYYRCFASWLYCHNETGNIYSHLIPGVLLLSSQGILYEYIRTTHGNLSNFDWSIVSLQLLTASICLLTSTTYHTLLNHSAAVAHRWLQLDYIGIIVLILGDFISGLHFGFYCNPQLKYFYWSLILAFSSATAVALLSPQFRGPEWRSFRLASFICTGLSALAPIGHACVLWGVPYLWKIGVQYYLLEGLFLIIGCYFWEVRVPESLYPGAFDIWGHSHTIWHVFVAFSIGAHVMGLLQGLEYSYSQAQCR*


> Neosartorya fischeri (PQRA5) NCBI:partial EAW20645.1

MAMTTVRLTFSYLLSSSSPKVVRNPPVKVSESVKKQRVFHASQIPAWMQWDPYILHGYRAQLDSYGQCFRSLFYLHNESVNTWSHIIPGMYFLTLLLAIDYWIIQLPLEVPVIDILAIQTYVAGTAGCLIFSAAFHATNAHSPEVAHAFLKLDYLGIVMTITTTCISVTYFALYSYPVLQVTYIFFTVLCAAIIFWVALDPQMDGARAGPCRSVFRAAVFSLLATSGLAPIFHVIWAEASSGLINIPLDSLTVTCSSYAVGTAVYVTRFPERFWPARFDLIGASHQIFHILVAFGQIVHLFGLREVLLRIHMGMCAV*


Dikarya; Ascomycota; Saccharomyceta; Pezizomycotina; Leotiomyceta; Eurotiomycetes; Eurotiomycetidae; Eurotiales; Trichocomaceae; Emericella; Emericella nidulans (aka Aspergillus nidulans)
> Emericella nidulans (PQRA1) NCBI:XP_662536.1

MPPRQRRPTEIHKKDPGGCQTASVATAVLEDPPRAIRSLVHWDELPHWQRDNQHIHTGYRPASYSFRGSFQSLTYIHNETVNIYTHLLPSVLAIPAAIQLYRALAPRYETATDGDIRAFGCFFVGAAFCLGMSAFYHTISNHSPTVARIGNTFDYIGIVGLIVGSFVPSVYYGFYCVPELQRLYWSMICTIGLGCIVVSIFPKFRTPRWRPFRAAMFVGMGLSAVFPVVHGLQLYGRDQMMRQIGLGWLLLQGFLYILGAGIYAARVPERLRPGGFDLWGSSHQIFHVLVVCAAVAHLTGLLRAFDYRHNGTAGSCQV*
> Emericella nidulans (PQRA1B) NCBI Genome

LYWDQLPSWQRDNQYILSGYRTVSNSFRESFASLGYLHNETVNIYSHLIPAILLSFFSIPLHTSLKARYTNVSTADTVVLSCFVLGAVLCLVISATFPTVQNHSPHVARIANQMDYIGIVFLIVGSFVPSIFYGFYCQPVLQTVYLTMVCSLGLLCAAVSATPQFRHPTWRPFRARMFIALGLSALFPVVHGVMRFGIRQMDKQIGLSWVVLQGSLYIVGACFYAQVPERIYPGVFDIWISSHQIFHFMVVMAIISHLYGLINAFDYNHNHLAIHC*
> Emericella nidulans (PQRB) NCBI:XP_662755

MACSTGSVTIESYLDTAVSSATPSEETALLRDRKRRHSFHTARKLSCDYDADAIFLRVELFLAELERRLHWIEQYRKSHMVQIDTSLRRAYATLEAVRDSCSHASGELMGSGKKRAKILVETLESRYNDALATKETLEQKAQAGVRLMESFLTELESRADAVRDRGVYGALDDGWKAVDSTLVQAREVMDEGIERARQVKDALRENIDHAIMLAKEKRLISYSDLPAPWRINPHILSGYRFHSSKVECLTSVFTFSNELVNIWSHLIGLIIVLSIAFYFYPLNPNFHLSTNSDTLVAAVFFFAACKCLVCSTLWHTMNSIADQPLMERFACVDYTGISLLVAASIVTTEYTAFYCEPTSRWVYILLTMSLGIGGVILPWHPTFNRADWAWVRVAFYVTLALTGFAPLAQLTYARGFSWCLYFYAPVMKSILVYFVGACVYASQIPERWKPGLFDYIGGSHNIWHLAVLGGILFHYLAMQDLFANAFQRAKGECPNLTS*
Dikarya; Ascomycota; Saccharomyceta; Pezizomycotina; Leotiomyceta; Eurotiomycetes; Eurotiomycetidae; Eurotiales; Trichocomaceae; mitosporic Trichocomaceae; Aspergillus; Aspergillus aculeatus
> Aspergillus aculeatus (PQRA1) JGI Genome

MAPRQRHSTHGQEKVLGTSQPAAVAAAVLEQPPKVLKKLLHWEELPHWQRDNQHIHSGYRPASASFLVSFQSLTYLHNETVNIYTHLLPSLLVVPAAFALYRALAPRYETATQADVIVFGCFFAGAAFCLGMSATYHTISNHSPMVARIGNAFDYAGIVGLTVGSFIPSVYFGFYCQPALQRLYWSMICTIGLGCVVVSIFPQFRTPGWRPFRAAMFVGMGLSAVFPVIHGLRLYGLGQMTRQIGLGWLVLQGLLYILGAAIYAARVPERLRPGQFDLWGSSHQIFHVLVVCAAIAHLTGLLKAFDYRHSGFAASCAWS*


> Aspergillus aculeatus (PQRB) JGI Genome

MACSAQSMTIESYPEANTSAYSTTPSEETSLLRDRRRRHSFHTARKLSLDYDADAVFLRVELFLTELERRMLWIEQYGKSHMDQIDASLRRGYATLEAVRDSCSHASGELMGSGKKRAKILVDTLEDRYKDALATKETLEQKAQAGVRLMESFLVELESRAHAGWDRGLDGALDGAWKAMDSSLVHAREVVDEGMERARRAKEAMKENIDRAILLAQEKRLIGYADLPQPWRVNPHILEGYRFTHSKVECLASMFTFSNELVNIWSHLIGLFIVLSVAFYFYPLNPNFHLSTKTDVLVAAVFFFAACKCLVCSTLWHTMNSIASQTLMERFACVDYTGISMLVAASIVTTEYTAFYCEPVSRWIYILLTMSLGIGGVILPWHPTFNRADMAWARVAFYVSLALTGFAPLAQLTYTRGFFWCLYFYAPVVKSVLVYFVGACVYASQVPERWRPGLFDYVGGSHNIWHLAVLGGILFHYLAMQDLFAGAFKRAQGECPNMVN*


> Aspergillus aculeatus (PQRA5) JGI Genome

MQWDPYIKHGYRAQLNSFRRCFWSLFHLHNESVNTWSHILPGVYFLVILLAIDYWIAPLPFEVPLSDILAVQTYVAGTAGCLVFSATFHATNAHSPEVARAFLKLDYFGIVLTISTTCISVAYFALHGSPLYQSIYILFTLFCAAMVFSVLLDAGMDGARAGPWRATVFILLAASGFAPIFRVVFWAGEEPCGWSRIPGESLIVTCSSYALGTIVYITRFPEAYWPSRFDLVGASHQIFHVLVAFGQIVHLFGLREMLRRIHS*


Dikarya; Ascomycota; Saccharomyceta; Pezizomycotina; Leotiomyceta; Eurotiomycetes; Eurotiomycetidae; Eurotiales; Trichocomaceae; mitosporic Trichocomaceae; Aspergillus; Aspergillus niger
> Aspergillus niger (PQRA1) NCBI:partial XP_001397765.1

MSTRQRRPTQVHEKDLGTSQPAVVAAAVLEQPSQVIRKLLHWDDLPHWQRDNQHIHTGYRPASFSLLVSLQSLTYLHNETVNIYTHLLPSLLAVPAAGLLYRALAPRYESATQADLVAFGCFFAGAAFCLGMSATYHTISNHSPLVARIGNTFDYVGIVGLIVGSFVPSVYFGFYCMPDLQRLYWTMICALGLGCILVSIFPHFRTPRWRPFRASMFVGMGLSAVFPVIHGLRLYGLEQMTRQIGLGWLLLQGFLYILGATIYAARVPERLRPGHFDLWGSSHQIFHVLVVCAAIAHLTGLLKAFDYRHSGIADSCLGAAQ*
> Aspergillus niger (PQRB) NCBI:XP_001392002

MACSSQSVTIESYPEAAVASAYATPGEDTGLLRDRRRRHSFHTARKLSCDYDADAVFLRVELFLAELERRLHWLEQYRKSHMDQIDASLRRGYATLEAVRDSCSHASGELMGGGKKRAKILVETLEDRYMDALATKETLEQKAQAGVRLMESFLVELESRAHAVRDRGLYGTLDDGWKAMDSKLVHAREVVDEGMERARRAKDALRESIDRAILLAQEQRLITYADLPHPWRVNPHILQGYRFTHSKVECLTSVFSPSNETFNIWSHLIGLFIVLSVAFYFYPLNPNFHLSSRTDILVAAVFFFAACKCLVCSTLWHTMNSIASQTLMERFACVDYTGISMLVAASIVTTEYTAFYCEPVSRWTYILLTMSLGIGGVILPWHPTFNRADMAWARVAFYVSLALTGFAPLAQLTYTRGLAWCLYFYAPVVKSIMVYFVGACVYASQVPERWRPGLFDYVGGSHNIWHLAVLGGILFHYCAMQDLFAGAFQRAQGECPNLAK*
> Aspergillus niger (PQRA4B) NCBI:XP_001388488.1

MQATFADSPSITETLPRQRKPSLPPGAFAEEPATPEKVLFNDDNEFIRHGYRPVSNSTHACFASWLYLHNETVNIYSHLVPAVFFLAAEGMFYQYLQVKYPEATLSDHAIFAFFLLTAVICLGLSTTYHTLMNHSLQVSELWLRLDFVGIIVLTLGDFVSGIYMVFYCEPLLRRLYWGMIISLSCITIMILVNPKFKGPRWRTFRVCTFVGTGLSGFAPLIHGISVFGFAKMMVQSDMPYYLGEGGLLILGALFYTMRIPESIKPGRFDIFGCSHQVFHVLVVLTTVVQLIGILSAFDYNYNHGKCRLP*
Dikarya; Ascomycota; Saccharomyceta; Pezizomycotina; Leotiomyceta; Eurotiomycetes; Eurotiomycetidae; Eurotiales; Trichocomaceae; mitosporic Trichocomaceae; Aspergillus; Aspergillus carbonarius
> Aspergillus carbonarius (PQRA1) JGI Genome

MLHVRNMSTRQRHPTQGHGKDLGTSQPAAVAAVVLEQPPNVLRKLLHWDDLPHWQRDNRHIHTGYRPASSSFLVSLQSLTYLHNETVNIYTHLLPSLLAVPAAGLLYRALAPRYESATQADLVAFGCFFAGAAFCLGMSATYHTISNHSPLVARIGNTFDYVGIVGLIVGSFVPSVYFGFYCMPDLQRLYWTMICTIGLGCVLVSIFPHFRTPRWRPFRAAMFVGMGLSAVFPVIHGLRLYGVEQMTRQIGLGWLLLQGFLYILGAVIYAARVPERLRPGHFDLWGSSHQIFHVLVVCAAVAHLTGLLEAFDYRHSGTADSCRGSAQ*


> Aspergillus carbonarius (PQRB) JGI Genome

MACSAQSVTIESYPKAKDMASASASAYATPGEDMALLRDRRRRHSFHTARKLSCDYDADAVFLRVELFLTELERRLHWLEQYRKSHMDQIDASLRRGYATLEAVRDSCSHASGELMGSGKKRAKILVETLEDRYMDALATKETLEQKAQAGVRLMESFLVELESRAHAVRDRGIYGALDDGWKAMDSKLVHAREVVDEGMERARRAKDALRENIDRAILLAQEQRLITYADLPHPWRVNPHILQGYRFTHSKVECFTSVFTFSNEMFNIWSHLIGLFIVLSIAFYFYPLNPNFHLSTKTDIFIAAVFFFAACKCLVCSTLWHTMNSIASQTLLERFACVDYTGISMLVAASIVTTEYTAFYCEPVSRWVYILLTMSLGIGGVILPWHPTFNRADLAWARVAFYVSLALTGFAPLAQLTYTRGFAWCLYFYAPVVKSILVYFVGACVYASQVPERWRPGLFDYVGGSHNIWHLAVLGGILFHYCAMQDLFAGAFQRAQGECPNLAK*


> Aspergillus carbonarius (PQRA4B) JGI Genome

MQVSFVDDAPIADFLPRRRKISVSFPAVPATGQVKSSDRVLLAYDEIPEWYQDNEFIQHGYRSVSNSTHACFASWLYLHNETVNIYSHLVPAVFFLAAEGMFYQYLQVRYPEATLGDHAVFAFFLLTAVICLGLSAMYHTLMNHTLHVSDLWLRLDFVGIIVLTLGDFVSGIYMVFYCEPVLRRIYWGMIITLSCITVLLLVNPRFQGPRWRTFRVCTFVGTGLSGFVPLIHDISVFGFAKMMEQSGMPYYLGEGVLLILGALLYALRIPESLRPGKFDIFGSSHQIFHVLVVLATAVQLIGILSTFDYNYRHRECRHP*


> Aspergillus carbonarius (PQRA4D) JGI Genome

MSSTLRPRLHIHTSTRTLSSFPPIPIPTHLRPLPPTTTLLSRQLWTTLHPSTLSIYTHFLPSLLLFILTIFISITINSPAKPILILNLLAATTTLLLSTTYHLHEHTPPTTANQFLCYDYTGIILLIVANYITGLYFGFYSHQDLSWRYISLILLLSTFPITTHLTPRYQSLEFDNLRVISLVLTALTALIPIVHGYGLYGGEYLWNVGVGWYLFEGAVFILGVGVYWTRIPERWFPESFWVEVCNSHVVWHVCVVVGIGVHFMGVISVIQFWFGKEML*


Dikarya; Ascomycota; Saccharomyceta; Pezizomycotina; Leotiomyceta; Eurotiomycetes; Eurotiomycetidae; Eurotiales; Trichocomaceae; mitosporic Trichocomaceae; Aspergillus; Aspergillus oryzae
> Aspergillus oryzae (PQRA1) NCBI:XM_001819714.1

MPSRQRRPTEKAQESKASTPAAMAATVMKQPPQVLKKLLHWDDLPHWQRDNHHIHSGYRPASFSFLVSFQSLTYIHNETVNIYTHLLPSLLAIPAAVWLHRALAPRYETATRADIISFACFFVGAAVCLGMSATYHTISNHSPTVARIGNALDYAGIVALIVGSFVPSVFYGFYCEPGLQRLYWTMICTIGIGCVFVSIMPQFRTPRWRPFRAAMFVGMGLSAVFPVIHGLRMYGLEQMTRQIGLGWLLLQGFLYILGAGIYAARVPERLRPGQFDLWGSSHQIFHVLVVCAAVAHLTGLLRAFDYRHSGIAESCSWN*


> Aspergillus oryzae (PQRB) NCBI:XP_001818492.1

MACSAQSVTIESYPEEAAVSSAYATPSEETTALLRDRRRRHSFHAARKLSCDYDADAVFLRVELFLAELERRLHWLEDYRRSHMVQIDASLRRGYATLEAVRDSCSYASGELMGGGKKRAKILVETLEDGYKDALATKETLEQKAQAGVRLMESFLSELEARAHAVRDRGFYGTLDDGWKAVDSKLVHAREVVDEGMERARKAKDALRENIDQAIALAQEKRLIAYADLPHPWRVNPHILEGYRFTHSKVECFTSMFTFSNELVNIWSHLIGLFIVLSVAFYFYPLNPNFHLSTKTDVLIAAVFFFAACKCLVCSTLWHTMNSIANQGLMERFACVDYTGISMLVAASIVTTEYTAFYCEPVSRWTYILLTMSLGIGGVILPWHPTFNRADFAWARVAFYVTLALTGFAPLAQLTYTRGFAWCLYFYAPVVKSILVYFVGACIYASQVPERWRPGLFDYVGGSHNIWHFAVLGGILFHYCAMQDLFAGAFQRAKGECPHLTS*


Dikarya; Ascomycota; Saccharomyceta; Pezizomycotina; Leotiomyceta; Eurotiomycetes; Eurotiomycetidae; Eurotiales; Trichocomaceae; mitosporic Trichocomaceae; Aspergillus; Aspergillus terreus
> Aspergillus terreus (PQRA1) NCBI:XP_001213764

MPTRQRRPTENRPKGSGSATSEAVSVAETVLEQPPRVIKKLLHWDELPHWQRDNHHIHSGYRPASYSFLGSLHSLTYVHNETVNIYTHLLPSLLSVPAAVVLYQALAPRYATATHGDIGAFSCFFAGAAFCLGMSATYHTISNHSPVVARIGNALDYIGIVGLIVGSFVPSVYYGFYCMPNLQRLYWTMICGIGLGCVFVSVLPQFRTPGWRPFRAAMFVGMGLSAVFPVLHGLRLYGRKLMMRQIGLGWLLLQGLLYILGAAIYAARVPERLRPGRFDLLGSSHQIFHVLVVCAAVAHLTGLLSAFDYRHSGIAETCPRI*
> Aspergillus terreus (PQRB) NCBI:XP_001212893

MACSAQSMTIESYPDEALSTSYAPTPSEETALVRDRRRRHSFHTARKLSCDYDADAVFLRVELFLAEMERRMHWIEEYRQAHMVQIDSSLRRGYATLEAVRDSCSFASGELMGGGKKRAKILVETLEDRYKDALATKETLEQKAQVGIRLMESFLTELESRAHAVRDRGIYGTLDDGWKAVDSKLVQAREAVDEGMERAKEALRESIDRAIVLAQEKRLITYADLPHPWRINPHILQGYRFTHSKVECFTSMFTFSNELVNIWSHLIGLFIVLSVAFYFYPLNPNFHLSTKTDVFVAAVFFFAACKCLVCSTLWHTMNSIANQGLMERFACVDYTGISMLVAASIVTTEYTAFYCEPVSRWTYILATMSLGIGGVVLPWHPTFNRADFAWVRVAFYVTLALTGFAPLAQLTYTRGFEWCLYFYAPVVKSILVYFAGACIYASQVPERWRPGLFDYVGGSHNIWHFAVLGGILFHYCAMQDLFAVAFQRAQGECPNLSA*
Dikarya; Ascomycota; Saccharomyceta; Pezizomycotina; Leotiomyceta; Eurotiomycetes; Eurotiomycetidae; Eurotiales; Trichocomaceae; mitosporic Trichocomaceae; Aspergillus; Aspergillus clavatus
> Aspergillus clavatus (PQRA1) NCBI:XP_001271061

MSVRQRHPAEGSENEPKTSQPAAIAAAVMEQPPQVVKKLLHWDDLPHWQRDNHHIHTGYRPASFSFLMSFHSLTYLHNETVNIYSHLLPSILSIPAALLLYRELAPRYETATRDDIIAFGCFFTGAAFCLGMSAIYHTISNHSPTVARIGNAFDYVGIVGLIVGSFVPSVYYGFYCVPGLQQLYWMMICTIGLGCAAVSVLPQFRTPRWRPFRAAMFVGMGLSAVFPVIHGLRLYGMEQMTRQIGLGWLLLQGFLYILGATIYAARVPERLRPGKFDILGSSHQIFHVLVVCAAVAHLTGLLRAFDHRRSGIAVSCPVDSI*


> Aspergillus clavatus (PQRB) NCBI:XP_001272631

MHWLEQYRKSHMDQIDSSLRRAYATLEAVRDSCSHASGELMGSGKRRATLLVETLEERYKEALATKETLEQKAQAGVRLMESFLIELESCAHTVRDRGIYGALDDGWKAMDSKLVHAVDEGMERARRAKDVLRESIDNAILLAQEQRLITYADLPHPWRINPHILQGYRFTSSKVECLWSVFSFCNETVNIWSHLIGLFIVLSVAFYFYPLNPNFHLSTKTDVMIAAVFFFAACKCLVCSTLWHTMNSIANQPLMERFACVDYTGISLLVAASIVTTEYTAFYCEPVSRWTYILLTMSLGIGGVVLPWHPTFNRADMAWARVAFYVTLALTGFAPLFQLTYTRGFVWCVYFYAPIVKSVLVYFAGACIYASQVPERWSPGLFDYCGGSHNIWHLAVLGGILFHYCAMQDLFANAFVRAQGECPNLAA*


Dikarya; Ascomycota; Saccharomyceta; Pezizomycotina; Leotiomyceta; Eurotiomycetes; Eurotiomycetidae; Eurotiales; Trichocomaceae; mitosporic Trichocomaceae; Aspergillus; Aspergillus flavus
> Aspergillus flavus (PQRA1) NCBI:XP_001819766

MPSRQRRPTEKAQESKASTPAAMAATVMKQPPQVLKKLLHWDDLPHWQRDNHHIHSGYRPASFSFLVSFQSLTYIHNETVNIYTHLLPSLLAIPAAVWLHRALAPRYETATRADIISFACFFVGAAVCLGMSATYHTISNHSPTVARIGNALDYAGIVALIVGSFVPSVFYGFYCEPGLQRLYWTMICTIGIGCVFVSIMPQFRTPRWRPFRAAMFVGMGLSAVFPVIHGLRMYGLEQMTRQIGLGWLLLQGFLYILGAGIYAARVPERLRPGQFDLWGSSHQIFHVLVVCAAVAHLTGLLRAFDYRHSGIAESCSWN*


> Aspergillus flavus (PQRB) NCBI:XP_002373732

MVQIDASLRRGYATLEAVRDSCSYASGELMGGGKKRAKILVETLEDGYKDALATKETLEQKAQAGVRLMESFLSELEARAHAVRDRGFYGTLDDGWKAVDSKLVHAREVVDEGMERARKAKDALRENIDQAIALAQEKRLIAYADLPHPWRVNPHILEGYRFTHSKVECFTSMFTFSNELVNIWSHLIGLFIVLSVAFYFYPLNPNFHLSTKTDVLIAAVFFFAACKCLVCSTLWHTMNSIANQGLMERFACVDYTGISMLVAASIVTTEYTAFYCEPVSRWTYILLTMSLGIGGVILPWHPTFNRADFAWARVAFYVTLALTGFAPLAQLTYTRGFAWCLYFYAPVVKSILVYFVGACIYASQVPERWRPGLFDYVGGSHNIWHFAVLGGILFHYCAMQDLFAGAFQRAKGECPHLTS*


> Aspergillus flavus (PQRA2) NCBI Genome

MSTKKDPTNQPKVKARIVTWQEISEW*FDNKYILSGYRPAKAGYLGMFTSLTFLHNESCNVYTHLIGALLLPLVATTLLRYLAEPQFLNVSSMDYAMFGLYFCCAEICLVLSALYHLMQPHSHHLEQFWHGMDLLGIVIVAMGTFASGIYYGFFCEASLQKLHWAIVSPSLTTGTVTGVLISNPLLRTPRWRKAKVGAFVIFSASSFIPLLHGVQRYGLEYMLQYSGIKWYLLDLTFYGTGVSLYAVRIPERLASGRFDIWGSSHQIFHVVILCAMYAHLTALLQGFTTCHTLDICRLRGIY*


> Aspergillus flavus (PQRA5) NCBI:partial EED50442.1

MASLRLALTCFLTPSPPKATENFHAANTEPPQKKQVFHASEIPEWMQWDPYIQHGYRTQLNSFKQCFLSLFYMHNESVNTWSHIVLEISFLILLLAIDYWIAQLPFKVPFSDMLAIQSYVAGTAGCLVFSAAFHTTNAHSPEVARAFLKLDYFGIVLTISTTCISVAYFTSTLQLAYILFTVLCAAMVFCITLDVGMDGARAGPWRFSFRATVFLLLAASDLAPIFHVGWNEGKCGLFRIPLDSLTVTCSSYAIGTLAYVTRFPERYWPGRFDLIVGACHQVFHVLVAFGQIVHLFGLREMLVSIHMVRCTM*


Dikarya; Ascomycota; Saccharomyceta; Pezizomycotina; Leotiomyceta; Eurotiomycetes; Eurotiomycetidae; Eurotiales; Trichocomaceae; mitosporic Trichocomaceae; Penicillium; Penicillium marneffei
> Penicillium marneffei (PQRA1) NCBI:XP_002143685

MAVKQPGKAIRKLLHWDELPPWLQDNHYIHHGYRPASSSFVVSFQSLAYLHNETVNIYTHLLPALVALPAGIRLYQVLAPRYQSATQGDISAFACFFVGATFCLGMSATYHTICNHSPSVARIGNALDYVGIVGLITGSFIPSVYYGFYCTPRLQSSYWTMICTIGIGCIIVCLTPKFRTPDWRPFRAMMFVSMGLSAIFPVVHGLWLYGPKQMTDQIGLYWLLLQGFLYILGATIYAARVPERLLPGRFNIFGHSHQIFHVLVVCAAVSHLTGLLQAFDYRHSGLAELCF*


> Penicillium marneffei (PQRB) NCBI:XP_002150634

MESIDASMRRGYAALEAVRDSCCAASGELMGGGKRRAKILVETLEERYNEALATKETLSEKAYAGMRLMESFLNDIEARSQLVRDAGITGTLDEGWKAVDSGLSHAREAVNEAVDEGMESIRRAKEALRESIDRAILLAQERRTIHYHDLPHPWRVNPHILQGYRFTASTKECITSVFSFSNELVNIWSHLIGLFIVLSIAFYFYPLDPNFHLSTKADIMIAAVFFFAACKCLVCSTIWHTMNGIANQKVMERFACVDYTGISFLVAASIMTTEYTAFYCEPTSRWIYILLTFSLGVGGVILPWHPTFNRSDMSWARVAFYSTMAMTGFAPLIQLSYSRGFEWCLYFYAPVVKSILVYGLGACIYASQIPERWFPGLFDYCGASHNIWHIAVLGGILFHYFAMQELFAGAFLRAEGECPNLTS*


Dikarya; Ascomycota; Saccharomyceta; Pezizomycotina; Leotiomyceta; Eurotiomycetes; Eurotiomycetidae; Eurotiales; Trichocomaceae; mitosporic Trichocomaceae; Penicillium; Penicillium chrysogenum
> Penicillium chrysogenum (PQRA1) NCBI Genome

MPRQRRPTEHQKVPSGSQSAEMTDIGEEAQILVKRLLHWDDLPHWQRDNHHIHTGYRPASSSFLSSFQSLGYVHNETVNIYTHLLPAVIAAPAAYGLYHLLSPRYRDAADSDILAFSCFFAGAAFCLGMSATYHTISNHSPVVARIGNALDYIGIVGLIVGSFVPSVFYGFYCVPELQHRYWTMICAIGLGCVIVSASPRFRTPRWRPFRATMFVGMGLSAVFPVLHGVSIFGLDLMQQQIGLNWLVFQGFLYILGAGIYAARVPERLMPGKFDIVGSSHQIFHVLVVCAAVAHLTGLLKAFDYRHSGAAETCQIPRG*
> Penicillium chrysogenum (PQRA4A) NCBI Genome

MALVKRLSPAERALSGTDRSDSPLLKEPSPSGPRLLNRDEVPSWYAQNPYIRTGYRPVTPSISRCLSSLVYLHNETVNVFSHVVPATIAFLGNGLLYGYFSTSFSDATWTDRLVFHIYLTTSVLCFGISSAYHTFLCHSVQVADVWVRLDYVAIVFQILGSFISGIYIGFYCEPHLQKLYWSMIGTLGFLTGFVVVHPRLQSQKWRLLRLSTLVATGLSAFAPIIHAASIFPYQQLDQQAGLRYYYLEGLIIVMGVLFYATHFPESWRPGSFDIWGSSHQIFHISVVIGAAIHLYGILVAFQWNYENQRCKIG*
> Penicillium chrysogenum (PQRB) NCBI Genome

MACSASSMAVESYPEEAYASATATPDENTSMLRDRRRHSFHAARKLSCDYQDADAVFIRVELFLSELERRMQWIEQYRKSHMVQVDASLKRGYATLEAVRDQCSLASGELMGSGKKRAKILVETLEDRYNEALVTKETLEQKAQAGVRLMESFLVEVENKMHAVRDRGIYGTLDDGWKAMDSGLVHAREIVDEGMERARRTRDTLRDTVEEAIRLAKEKRLINYHELPHPWRVNPHIINGYRFTTSKVECISSVFAYSNEMFNIWSHVIGLVIVLAIAFYFYPLHTNFHLSTKSDVTIAAVFFFAACKCLVCSTIWHTMNSIASQSLMERFACVDYTGISMLVAASIVTTEYTAFYCEPLSRWVYILLTMSLGVGGIILPWHPTFNRHDMAWARVGFYVTLALTGFSPIAQLSYTRGFEWTMYFYAPVVKSIMVYFVGALVYASKIPERWKPGLFDYFGGSHNIWHIAVLGGILFHYHAMQDLFAGAFQRAQGECPNMTS*
> Penicillium chrysogenum (PQRB1) NCBI Genome

MCSWKTAMITRRSTPPLEDTQLLSEGSPATPKSDNQSYWPTIGSKDQIPGWLRDNDYILEGHPMPTFCYKRSLRLWRCLHMETMNIWTHLLGSIAFITVALTLNCFVSVSRDFNFTRGDVFAFGSFLASATICFGLSAGFHTLRSHSYNIHHLWGKMDILGICFLALGAGTSMTYYAFYCRPFFQRMYWGLNLFSAVGAAITLFDTGGGGNKMRTLRGGVFSLLAISAMLPIFQSVIELGWTRASNEIGAGWYLAEALSLLTGVSVFVCRFPERLSPGTFDIWGHSHQLWHMFAVLGSAFHVVALLVAYDYRRMHKVC
Dikarya; Ascomycota; Saccharomyceta; Pezizomycotina; Leotiomyceta; Eurotiomycetes; Eurotiomycetidae; Eurotiales; Trichocomaceae; Talaromyces; Talaromyces stipitatus
> Talaromyces stipitatus (PQRA1) NCBI:XP_002479999

MVVKQPAKAIRKLLHWDELPPWLQDNHYIHSGYRPASSSFLVSFHSLTYLHNETVNIYSHLLPALVALPAGIRLYQVLAPRYQSATQADISAFACFFVGATFCLGMSAIYHTISNHSPSVARIGNALDYVGIVGLITGSFIPSVYYGFYCALSLQCIYWTMISTIGVGCIFVCLLPRFRTPEWRPFRAMMFVSMGLSAIFPVIHGLWLYGPKQMIDQIGLYWLLLQGFLYILGATIYAARVPERLLPGRFNIFGSSHQIFHVLVVCAAVSHLTGLLRAFDYRHSGLAELCF*


> Talaromyces stipitatus (PQRB) NCBI:XP_002483514

MESIDASMRRGYAALEAVRDSCCAASGELMGGGKKRAKILVETLEGRYNEALATKETLSEKAYAGMRLMESFLSDIEARSQLVREAAGISSAFDEGWKAVDSGLNHAREAVNEAVDEGMESVRRAKEALRESIDRAILLAQERRLIHYHDLPHPWRVNPHILQGYRFTASPKECVTSVFSFSNELVNIWSHLIGLFIVLSIAFYFYPLNPNFHLSTRADIMIAAVFFFAACKCLVCSTIWHTMNGIANQKVMERFACVDYTGISFLVAASIMTTEYTAFYCEPTSRWIYILLTFSLGIGGVILPWHPTFNRPDMSWARVAFYSFMALTGFAPLIQLSYSRGFSWCLYFYAPVMKSILVYGLGACIYASQIPERWFPGLFDYCGASHNIWHIAVLGGILFHYFAMQELFADAFLRAKGECPNLTA*

1   2   3   4   5   6   7   8   9   10


Verilənlər bazası müəlliflik hüququ ilə müdafiə olunur ©azrefs.org 2016
rəhbərliyinə müraciət

    Ana səhifə