If no accession number is given or only a partial protein sequence is found in the database then the protein sequence was derived from genomic sequence. Grey shading indicates genomes that are complete according to ncbi




Yüklə 371.95 Kb.
səhifə3/10
tarix23.04.2016
ölçüsü371.95 Kb.
1   2   3   4   5   6   7   8   9   10

> Candida tropicalis (Izh2p) NCBI:XP_002550231

MSKSNTTIRQRSQSKQQQVNEYSSLNSETPLQKRLHYYHELDEWQQDNHFIRSGYVKQTDSYKECLNSLTYLHNESVNIYSHLLPSSISFWAVLFYINYILPQYSNYLGTWEKLNFLQFGAAATFCMFMSSTFHCLKSHSHKVCKFGNQLDYFGIIILITCSLNSIVFFAYYDYPILRNVFVGLSVFFGSICTILTLDPKFASVDYRPFRSFMFILFGLSGVLPISTGIYLFGVETTNERCGFYWVLAEGIGYIFGAVLYAARIPERFTYKHQEDHELETNPHSGMFDIFGHSHQIFHVMVVLSAFCHWKALVQTYHYLHLQILPSM*


> Candida tropicalis (Izh3p) NCBI:XP_002551130

MASATTTALEVPAQDSLKNRSNRSRSPSNVIETAEEVLVEKLDYFISSIESRLVRFEQFFKFNNEEREFIEQRLKSSQPAGREVGNGHRRTSSSSSIQQFRQFSANKLDLICERLELIKKSMLRNSFSNLDTLYKLLDDQYNYLFSNSAVIDEEEDLDDLNNVDSTNIGPYDDDGCTDEDSKSMKKREILSKKIITTIQYFDEKLLAIDDFIKESRPAATDDYSHDAVFSQLRFFNFNRALRNARKRYLHYYELPLVWRENKYIISGYRFSLSHKEMLKSMFHFNHNESMNIWSHIIGLVVVLYICIYHFPLTDVFEQNSRNDNILVYVFLVAAAKCLVNSSLWHTYSCFAHYPTRSAFACVDYTGITVLITSSILTVEYCALYKYPKLLITYVVCAIICGVAGLAFNWSPYFDKPECRSIRIGFFVGLSASGASSLVCKAFYDGVLSSLSLVAPLIYKSFVWYCLGVVFYGGLIPERWRYDVIIEENLSKSNRHYQATDVILEKTGHDGEEEMEVLHEEFEDIIEDESKQNGNDSMNEDEKFQDLINKHFKSKLTKSPYCNNFMSLWWVDYFMASHNIWHICVVLGILGHYFCVLDMFRGLERDI*


Dikarya; Ascomycota; Saccharomyceta; Saccharomycotina; Saccharomycetes; Saccharomycetales; "CTG Group"; mitosporic Saccharomycetales; Candida; Candida parapsilosis
> Candida parapsilosis (Izh2p) NCBI Genome

MVSEQVSTIRQRQTQESSVDPKQGPAQTSPRIVAQLESRNPLARRLAYYHELDEWQQDNHYIRSGYVRGTSLYLESFKSLGYWHNETINIYSHLLPSSISFWLILYYVNFQLAMYDNYLGVWEKLNFIQFGLACTFCMFMSSVFHTLKSHSHKVSKFGNQLDYFGIVILITCSLISIILFAYYDEPLEKWIFVSLTLFFGTVCTVFTLHPEFSKNHYRPFRSTMFILFGLSGVLPVAFGVYKFGAATTLDRAGVKWLILEGLFYILGAVLYAARFPERLTHVEEDEHLLLLNPQAGKFDIIGHSHQIFHVFVVIAAYCHWLALVQCYHYLHQHILA*


> Candida parapsilosis (Izh3p) NCBI Genome

MSTSTATELYSQGTDARNRSIHERHHQRTSSTVEELLIEKLDYFVSSIEARLNNFDIFFKWKEAHADDDNDNDHDLADYNDKPIKTTTNIYHTSAEYSSGNLLSSRSRSDSTASLQSLKELSIIKLNLIRDRLRLIKKSVLSKGFTNVEFLYNLLADQYDYLFNSVVDPSMVMDDDEIGSHEKPMKESSTSSPLSSPSPREVLSNKLIDIIYYFDQKLTNIDDYLREKNAIVEGGIKDLQENGASEQPHFINLRYFNFNRALKNAARNKYVHYYELPLMWRENKYIIQGYRFSLKHSEMWKLIFAWHNETMNIWSHLVGVGVVLYIALVQFPSTTVFEVMSKGDKLFMYLFLVAALGCLVSSSTWHTYSCFAHYPSRANFACIDYSGITLLITCSVIAIEYCALYNYPNLSLAFIIFTMACGLGGFAFNWSPYFDKPECRPLRIGFFIGLSFSGSTALLCQSWYYGPWHALWFVLPLFYKSFAWYLLGVVFYGGLIPERWRFDVIIEENNAVGAGCHHHYDAIDVIEDKVGHAGEEEIDQIELELLELELHRLQKVKDALAPAKASDEAELSADNVEHDSGTDLDDNDNEEEEEEEEEEEEDDDFKRLVKKHFKKEPTKTPYANKFMSLWWVDYFMASHNIWHICVLLGILGHYSCLVHMFNEIKGILK*


Dikarya; Ascomycota; Saccharomyceta; Saccharomycotina; Saccharomycetes; Saccharomycetales; "CTG Group"; Metschnikowiaceae; Clavispora; Clavispora; lusitaniae
> Clavispora lusitaniae (Izh2p) NCBI:EEQ36405.1

MSLRQRNTTSNTYERKEPNAMSKARRVYYYHELDPWQQDNHYIRSGYVKETASYKECIKSLTYLHNESVNVYSHLLPSIFSSIAVIVFINWRIEKYENDLGIWERLNFLQFGGAATFCLTLSALFHLFKSHSHKASKFGNQCDYFGIIVMITCSLNSIILFAFYDVPKVRNGFLLLFFLLGTACTKVTFDDKFSTPDYRPFRSFMFILFGLSGTLPIVAGVKMFGWKDAIGRSAANWCCAEGVFYILGACLYALRVPERFFHVEHPEGEEETLLDKMKPGKFDLFGHSHQIFHVMVVVAAYCHWKALVACYHYLHTRTLS*


> Clavispora lusitaniae (Izh3p) NCBI:EEQ36898.1

MSTTIVSGVRNRNHTNKLPPQVTETQTSESLLIEKLDAFLSSIELRLERFERYFQVVGAGASETLVESEGNGKNPTQSHNRRGSTASLSSLKTLSATHMNQVYEQLRSVKDHVLQTSITNLEYLYKTLDEKYNDLFSNDESSLILPEEDVTNEALSTNIINTIQFFEQKLSHIDQFIKSRTPAATDNYDHDSKFNRFRFFNFNKALKEAEEKYLHYYQLPLSWRENRYIIHGYRFSLQHKDILKSMFHFNHNETGNIWTHIIGTVLMLYLGLVHFPKTDVFAANTWVDNMVMYVFLLAAIECLVSSVLWHTYSCFAHLQIRNRFACVDYTGITVLITCSVISAEYCALYNSSKLLYLFVGFSIISGLSGLLLNWSPYFDKPECRPLRIVFFVCLALLGGTTFLCKWRYEGFLPSLYFYLPLVYNSFVWYWTGVVFYGGLIPERWRYDIIINEDSTCRHTHTTSDVLTGHIENCGEEEMEEMEHEMEELGLHEELDSVSVTVEAEDSDSEDKIQDILAKHFPAEPMRTPYHRDLFSLWWVDYILSSHNIWHVCVVLGVTGHYFSLLSMYRCVRQIS*


Dikarya; Ascomycota; Saccharomyceta; Saccharomycotina; Saccharomycetes; Saccharomycetales; unknown; Candida caseinolytica
> Candida caseinolytica (Izh2p) JGI Genome

MAVRTRMQTRKDCTPESPSLEPSKSHLVSWDNLESWRKDNKYITSDYRRVCYSYKECVKSAVHRHNELMNIHTHQIPAILLFACWLFSIDKIFPSYYHLATFPEKLSLSIFIICSGLCLCFSGTFHCFNSHSEKAWHTFQCYDHMGIILYGIGSAMPSYYYAYYDKPTVYYILWLALGAVAVGSIYFIFSPDFRSPVYRAVRARLYILLGSSSTIPTFMSLYIYGVDEISKRLDTHNLILEMFLHSIGAVIYALRLPESIAPGKFNVFGGSHQIFHLFVVAGITAHIISLRHAHAFLHNLSP*


> Candida caseinolytica (Izh3p) JGI Genome

MEAKHSEEAHTSQEAVLERLDAFLHSLEQHLDQFEKYGLHKLSDIDREVVTMYQQFSSVRDSCQVQAGEMISRSRSRLDKFIEIGGDATKYAKDSLANRSHEYLHSMEEKLGEFENQVSDIIKKIDMQTEQFNETVRLAFQKYKTALLTIDDLPQDWKENPYILRGYRFCDTSLSCFASIMSLHNETCNIWTHLLGFLGILSIAVYFYPNSEIFAQSTGYDKAIIYMYLTCAMSCLGFSTLWHIYSGIGHIHIKRRAACLDYTGISIQISGSILATQYYAFYCQPVKQLCYMSCTAVLGVIGAYMTSSPTFDLSDNRIIRIAFFVGFALLGLVSVLHLSYERGLSLTMSFFWPVVKSNLWYLYGLVFYGLLIPERFFPGTVFDWIGMSHNFWHIAVFAGVYFGYEAFQQQMAQAEAYSCM*


Dikarya; Ascomycota; Saccharomyceta; Saccharomyceta; Saccharomyceta; Pezizomycotina; Leotiomyceta; Dothideomycetes; Pleosporomycetidae; Pleosporales; Pleosporaceae; mitosporic Pleosporaceae; Alternaria; Alternaria brassicicola
> Alternaria brassicicola (PQRA1) NCBI:AB02593.1

MEATKKATSKAAETGKELEQKVEEKLILLWDEISPWQQDNHYIQSGYRAQSNSYIKSWKSLGYLHNESVNIYTHLIGALMAAISSVALYSTLAPRYETATREDVWAFGCYFAGAVACLGMSGTYHTIQNHSHEVAVWGNKLDYLGIVFLIWGSFMPVIYYAFGSVPELRRAYWAMITTLAAGTSVVATHPKFRTPALRPFRALMFVLMGLSAVFPVLHGVRLFGVEHLRKSIGLDWVLLQGALYIAGAAIYAARVPEKWSPGKYDIWGSSHQIFHVLVVLAAASHLVALALAFDYEHGQRMGSIEEVMGGKIWP*


> Alternaria brassicicola (PQRB) JGI:AB07841.1

MASQEEPIQPTYRGYGTIASQRPVQRQRRHSWHTRPCMQEAENFQLLLRNFLVELNCRMDLLEDYGHLKYDAGVEYAYNTLLAVRESCSKTADDAIEAGRRQASVFVETLEGRYKDAMERKETLGEKVLEGIMLMDNYLTEFETRAYAIRDGSIGSYAQEFYEEGRRKMDEGIEIAKGVVDGGLDKARRARETIELRVEHAVQRALERAKAHGLIHYEDLPEPWRVNPHILKGYRFQEGKWACVRSIFGLHNELINIWTHLLGFIMVLAIAFYFYPSSANFSMSTKADIFIAAVFFFAACKCLACSTIWHTMNSISHQTLLERFACVDYTGISLLVAASIMTTEYAAFYCEPVSRWSYMCITALLGIGGVILPWHPTFNRADMAWLRVLFYCSLALTGFLPFGQLAYTRGVEWAQYFYAPVAKSLLVYITGALLYASKTPERFFPGFFDYVGCSHNIWHVAVLGGIIFHYMAMQTMFTQALTRAQTSCSVY*


> Alternaria brassicicola (PQRA3A) JGI Genome

RRSTNKLNAVPWQQDNEFILTSHRRATFSYLRSLKSIFEVHNESVNIWSHILGTAVFFCIPFVFYFSTPQTCVEEDCRSGDDGAIYVYFSSVIACFFFSSMYYIFLDHSEQVRTWTSRFDYLGIVIPLYGTTIASSHFGLHCEPTLQDAYSGFATVACLACALTTLHPSFSGPQSRHLRAALYLLLGLSSFLPIIHGISLYGLEAMNHRMGLGYYLGLGLCHGTGATLYAARIPERWFLRRCDVVGSSHQIMHVLVVCGAATYGVGILGAKRYWQTRGCEE*


> Alternaria brassicicola (PQRA4A) JGI:AB02650.1

MATHDSISSPPKEALRLDTPVKLHDSHQVPSWYAHNAFITTGYRPVTKSLPLCIRSLSYLHNETVNIYSHLVPAIAVLLASYSFDRYFTSRFPQATWTDELVFRIFLTTSVICFGTSAAYHMLICHSETYASLWVRLDYVAIIVQIVGSFIPGLYFGFYCEPNLQKLYWSMIVTLGTLTATTVINPSLHGPRWKTLRLSAFVATGFSAFAPIAHGALLFPYGQFDRQTGLRWYYLEGVLIMMGVWFYATHFPESCRPRRYDIWGASHQLFHVFIVLSAMAHYYGVMSAMEWNYVHQRCQWS*


Dikarya; Ascomycota; Saccharomyceta; Pezizomycotina; Leotiomyceta; Dothideomycetes; Pleosporomycetidae; Pleosporales; Pleosporaceae; Pyrenophora; Pyrenophora teres
> Pyrenophora teres (PQRA1) JGI Genome

MDTAKEAASAAADKGKELEQKVEEKLILLWHEISPWQQDNHYIRSGYRAQSNSYVKSWKSLGYLHNETVNIYTHLIGALLAAISGVVLYQTLESRYETATREDMYAFGCYFAGAIACLGMSGTYHTIQNHSHEVAAWGNKLDYLGIVFLIWGSFVPVLYYGFGEQPELRKTYWAMITTLAAGTSIVSTHPKFRTPALRPFRALMFVLMGLSAVFPVLHGVRLYGVEHMRESVGLDWVLLQGVLYIAGAAIYAARVPEKWSPGKYDIWGSSHQIFHVLVLLAAASHLVGLVKAFDFAHSQKMGGIKNVLEDAIRS*


> Pyrenophora teres (PQRB) JGI Genome

MPRSKSSVAVSTAVMASQEEPIQPTYRGYGTFASQHAAQRQRRHSWHTRPCMHEAENFQVLLRNFLAELNCRLDLLEDYGHVKYDAGVEYAYNTLLAVRESCSKISDGAIEAGRRQASVFVETLEGRYTDAMEKKETLGEKVLEGIVLMDSYLTEFEARAFALRDGSIGSYAQEVYEGGLRKMDEGIEIAKGVVDGGLDKARRARETIEIRVEHAVQRALARAKAHGLIHYEDLPEPWRVNPHILKGYRFKEGKWACVRSIFGLHNELINIWTHLLGFIMVLAIAFYFYPSSTNFSMSTKADIFIAAVFFFAACKCLACSTIWHTMNSISHQTLLERFACVDYTGISLLVAASIMTTEYAAFYCEPVSRWSYMCITALLGIGGVILPWHPTFNRADMAWLRVVFYCSLALTGFLPFGQLAYTRGVEWAQYFYAPVTKSLLVYITGACLYASKTPERFFPGFFDYVGCSHNIWHVAVLGGIIFHYMAMQTMFTQALTRAQTSCSVY*


> Pyrenophora teres (PQRA3A) JGI Genome

MTSHNRQDAREKAGTGLLTGPKGECNERYGATAQRHVRFDESDAGVKLKHEDGDVHVVDYNALLGWDELLPWQQDNEFILRSHRRATNSYLRSLKSVFRVHNETVNIWSHLVGAAIFFSAAVLLYLRRNSKGLRDDRYSTNADDVAVDIYFVSVITCFFFSFIYHIFLDHSECTRIWTARFDYLGIVIPLWGTTMSSTHFGFYCEPRLQNAYAIVGTFAGLACAFTTLHPSFAGPASRRFRSGMYVFLGLSSFVPIIHGILLFGLDAMNKRMSLWYYVALGLFHGSGAALYASRVPERWWPGRCDVVGSSHQVMHVLVVLGAATYAVGVLRAREYWTGVDFVTLH*


> Pyrenophora teres (PQRA3B) JGI Genome

SINRLRISEQRDNEYILSSYRYVVNMFSHLIGAILF

FTLPIPVYYTLRSRYGEANTTDVVVFSTFFFGVAICFALSASFHIFNNHSESVHILGNQLDYVAGLRKY

FHRPKYRPYRAIIYAGLGLSFVIPIFHGITRFGWETQMWRMSLDWMALMT

IFNLTGGAPYAMRVPEKWYPYRFDIWGSSHQIMHCLVICAGIAHLFGLLRAFDHIHGHGNICAS*
> Pyrenophora teres (PQRA4A) JGI Genome

MARGANDRTDRRTDAKTSTPPEMSYKLLTRDQVPSWYAQNPYIITGFRPVTKSIPLCLRSLAYPHNETVNIYTHLIPAITALLCSYSFGKYFNSQFPHASWADEIVFRIYLTVCVICFGTSAAYHTLLCHSQAYESLCVRLDFVAIVMQIVGSFVPGLYFGFYCEPHLQKLYWTMIITLGALTVTAVIHPSLQGSKWRSLRLSTFVATGFSAFAPIIHGATIFSYSQMDQQSGLRYYYLEGVLVLAGVAFYAMHFPECSKPKKYDILGSSHQIFHVFIVLSALAHFYGLMTAFEWNYENQRCNWV*


Dikarya; Ascomycota; Saccharomyceta; Pezizomycotina; Leotiomyceta; Dothideomycetes; Pleosporomycetidae; Pleosporales; Pleosporaceae; Pyrenophora; Pyrenophora tritici-repentis
> Pyrenophora tritici-repentis (PQRA1) NCBI:XP_001938890

MDTAKEAASTAATKGKELEQKVGEKLILLWHEISPWQQDNHYIRSGYRAQSNSYAKSWKSLGYLHNETVNIYTHLIGALLAAISGVVLYQTLEPRYETATREDIYAFGCYFSGAIACLGMSGTYHTIQNHSHEVAVWGNKLDYLGIVFLIWGSFVPVLYYGFGEQPELRKTYWTMITTLAAGTSIVSTHPKFRTPALRPFRALMFVLMGLSAVFPVVHGIRLYGVEHMRESIGLDWVVLQGVLYIAGAAIYAARVPEKWSPGKYDIWGSSHQIFHVLVVLAAASHLMGLVKAFDFAHSQKMGGMKNVLE*


> Pyrenophora tritici-repentis (PQRB) NCBI:XP_001933230

MASQEEPIQPTYRGYGTFASQHPAQRQRRHSWHTRPCMQEAENFQVLLRNFLAELNCRLDLLEDYGHLKYDAGVEYAYNTLLAVRESCSKISDGAIEAGRRQASVFVETLEGRYTDAMEKKETLGEKVLEGIVLMDSYLTEFETRAFALRDGSIGSYAQEVYEGGLRKMDEGIEIAKGVVDGGLDKARRARETIEIRVEHAVQRALARAKAHGLIHYEDLPEPWRVNPHILKGYRFKEGKWACVRSIFGLHNELINIWTHLLGFIMVLAIAFYFYPSSTNFSMSTKADIFIAAVFFFAACKCLACSTIWHTMNSISHQTLLERFACVDYTGISLLVAASIMTTEYAAFYCEPVSRWSYMCITALLGIGGVILPWHPTFNRADMAWLRVVFYCSLALTGFLPFGQLAYTRGVEWAQYFYAPVTKSLLVYVTGACLYASKTPERFFPGFFDYIGCSHNIWHVAVLGGIIFHYMAMQTMFTQALARAQTSCSVY*


> Pyrenophora tritici-repentis (PQRA3A) NCBI:partial EDU42651.1

MPCLDGTSCVSLTHYPHWSLTVTTRKHANSSVTVPWQQDNEFILTSHRRATNSYLRSLKSVFRVHNETVNIWSHVMGVAIFFCAAVLLYLRRNSKGHLDGRYSMNADDMAVGIYFLSVITCFFFSFMYHIFLDHSECTRTWTCRFDYLGIVIPLWGTTVSSTHFGFYCEPGLQNAYAIIGTFAGLACAVTTLHPSFAGPASRRFRTGMYVFLGLSSFLPIIYGILLFGLDAMNKRMSLWCYVALGLLHGSGATLYASRVPERWWPGRCDVVGSSHQVMHVLVVLGAAVYAAGVLRAREYWTGVSCVTLH*


> Pyrenophora tritici-repentis (PQRA3B) NCBI:partial EDU50589.1

MGIRSRKESSTINAERRVCEFPSSIEPSAYLSKAAPDDRMKNKSLSSLLTWDERDNEYILSSYRCVSVNIFSHLLGSMLFFTLPIPVYYTLQPIYNAANTADVVVFSTFFFGVAICFALSASFHIFNNHSENVHIFGNQLDYLGIVILMWGSTIPCVYYGFYCTPSLQKIYYTLVSVLAAGCVYATLHPAFRRPKYRPYRAIMYAGLGLSFIIPIIHGIMKFGWETQMWRMSLDWMALMTIFNLTGGALYAMRIPEKWYPYRFDIWGSSHQIMHCLVICAGIAHLFGLLRAFDHIHGRGNICDS*


> Pyrenophora tritici-repentis (PQRA4A) NCBI:XP_001938739

MARGASNRTDRRTDTKTSTPPEMSYKLLTRDQVPAWYAQNPYIITGFRPVTKSIPLCLRSLAYPHNETVNIYTHLIPAITALLCSYSFGKYFNSQFPHASWTDELVFRIYLTVCVICFGTSAAYHTLLCHSQAYESLCVRLDFVAIVMQIVGSFVPGLYFGFYCEPHLQKLYWTMIITLGALTVTAVIHPSLQGSKWRTLRLSTFIATGFSAFAPIIHGATIFTYSQMDQQSGLRYYYLEGVLVLAGVAFYAMHFPECSKPKKYDILGSSHQIFHVFIVLSALAHFYGLMTAFKWNYENQRCT*


Dikarya; Ascomycota; Saccharomyceta; Pezizomycotina; Leotiomyceta; Dothideomyceta; Dothideomycetes; Pleosporomycetidae; Pleosporales; Pleosporaceae; Cochliobolus; Cochliobolus heterostrophus
> Cochliobolus heterostrophus (PQRA1) JGI Genome

MDAVKEAASKAADAGKKIEEKVEEKLIVVWDELSPWQQDNHYIQTGYRAQSNSYSKSWKSLGYLHNETVNIYTHLIGALLAAVAGIALYFTLGPRYATATTEDVWAFGCFFAGAVACLGMSGTYHTIQNHSHEVAVWGNKLDYLGIVFLIWGSFVPVLYYAFRDEPELRKTYWAMITTLAAGTSIVSTHPKFRTPALRPFRALMFVLMGLSAVFPVLHGIQLYGIEHLRRSIGLDWILLQGTLYISGAAIYAARVPEKWSPGKYDIWGSSHQIFHVLVVLAAASHLNGLVQAFDYEHGQRRSEITAALGSKGL*


> Cochliobolus heterostrophus (PQRB) JGI Genome

MPLMAPSNSSFGVSSAVMTSQEEPIQPSYRGYGTFASQRPAQHQRRHSWHTRPCMQEAENFQVLLRNFLTELNCRLDLLEDYGHLKYDTGVEYAYNTLLAVRESCSKISDGAIEAGRRQASVFVETLEERYKDALECKETLGEKVLEGIVLMDNYLTEFEARAFALGDASIGTYAHEFYEEGRRKMDEGIEIAKGVVDGGLDKARRARENIELRVEHAVQRALAQAKAHGLIQYEDLPEPWRVNPHILKGYRFQEGKWACVRSIFRLHNELINIWTHLLGFVMVLAIAFYFYPSSANFSMSTKADIFIAAVFFFAACKCLACSTIWHTMNSISHQTLLERFACVDYTGISLLVAASIMTTEYAAFYCEPVSRWSYMCITALLGVGGVILPWHPTFNRADMAWLRVVFYCSLALTGFLPFGQLAYTRGVVWAQYFYAPITKSLLVYVTGACLYASKTPERFFPGLFDYIGCSHNIWHLAVLGGIVFHYKAMQAMFTQALTRAQTSCSLY*


> Cochliobolus heterostrophus (PQRA3A) JGI Genome

TVHWQQDNEFILTKHRRATFSYQRSLRSVFQIHNETVNIWSHILGTAGFLYPMGALGLCMRELDRHAKDDLAVLIYFISVIACFFFSFAYHIFLDHSQSARIWTSRFDYLGIVVPLWVTTIASTHFGFRCEPDLRKTYSVFATGAGLACAVTTLHPSFTRTASKGFRTVTYLLLGLSSFLPIIHALRLFGWQQMEQRMSLSYYLALGLCHGTGATTYASKVPERWYPKRYDLVGSSHQIMHVLVVCGAAAYGLGVLKAREHWKGFDCARLQ*


> Cochliobolus heterostrophus (PQRA3B) JGI Genome

MDVRSRKTASTVTAVAENATDPRDRMKSKERASLLTWDEIPDWYQDNEYLLSSYRAVSQSYKRSLKSILGIHNETVNIFSHIIGSIVFFTLPVPIYCSLQPRYATATTADVVVFSTFFFGVAICFALSAIFHIFNNHSQSVHIFGNQLDYLGIVILMWGSTIPCVYYGFYCTPHLQKTYYSLVSVLAAGCVYATLHPAFRRPKYRPYRAAMYAGLGLSFIIPIIHGITIFGWETQMWRMSLDWMALMTAFNLTGGALYAMRIPEKWYPYRFDVWGASHQIMHCLVVCAGIAHLYGLLRAFDHIHGHGNACTVLHE*


> Cochliobolus heterostrophus (PQRA4A) JGI Genome

MTSHQDPRSTTSSKPLFPFTVPKLHQSTDLPAWYAHNSFIQTAYRPITKSTRLCLQSLTYLHNETINIYSHLLPALLSLFFSHSFSTSFAAQFPHATWKDEVMFRVFLSTCVICFGTSAAYHTLICHSRTFAELWVRLDYVGIVVQIVGSFIPGIYFAFYCEPQLQKVYWSMIITLGTMTATIVLSPGLQGPKWKYLRLSTFVAMGLSAFAPIIHAASIFPYSQLDQQSGLRYYFLEGVLILIGVGFYAAHFPESWKPKRYDVCGASHQIFHIAVVLGALAHYYGIMSAFEWNYANQRCMW*


Dikarya; Ascomycota; Saccharomyceta; Pezizomycotina; Leotiomyceta; Dothideomyceta; Dothideomycetes; Pleosporomycetidae; Pleosporales; Pleosporaceae; Cochliobolus; Cochliobolus sativus
> Cochliobolus sativus (PQRA1) JGI Genome

MDVVKEAASKAADAGKKIEQKVEEKLILVWDELSPWQQDNHYIQTGYRAQSNSYSKSWKSLGYLHNETVNIYTHLIGALLAAVTGIALYFTLGPRYATATTEDMWAFGCFFVGAVACLGMSGTYHTIQNHSHEVAVWGNKLDYLGIVFLIWGSFVPVLYYAFQDEPELRKTYWAMITTLAAGTSIVSTHPKFRTPALRPFRALMFVLMGLSAVFPVLHGIQLYGIEHLRRSIGLDWILLQGVLYISGAAIYAARVPEKWSPGKYDIWGSSHQIFHVLVVLAAASHLNGLVQAFDYEHGQRRSEITAALGSKGL*


> Cochliobolus sativus (PQRA3B) JGI Genome

MNIRSRKSASTVTVVAENAADPRDRMKSKERTSLLAWDEIPDWYQDNEYILSSYRAVSWSYKRSLESILSIHNETVNIFSHIIGSIIFFTLPIPIYWSLQPRYATAITADVVVFSTFFFGVAICFALSATFHIFNNHSQNVHTFGNQLDYLGIVILMWGSTIPCVYYGFYCTPHLQKTYYTLVSVLAAGCVYATLHPAFRRPKYRPYRAAMYASLGLSFIIPIVHGITIFGWETQMWRMSLDWMALMTAFNLTGGALYAMRIPEKWYPYRFDVWGASHQIMHCLVVCAGIAHLYGLLRAFDHIHGHGDTCTL*


> Cochliobolus sativus (PQRA4A) JGI Genome

MTSHQDAKPSTPLFPFTIPKLHQSTDLPAWYAHNSYIQTAYRPITKSTRLCVQSLTYLHNETINIYSHLLPAFLSLFFSHSFSTSFAEQFPHATWKDEVMFRVFLSTCVICFGTSAAYHTLICHSHAFAELWVRLDYVGIVVQIVGSFIPGIYFAFYCEPRLQKVYWAMIITLGTLTATIVLSPGLQGPKWKYLRLSTFVAMGLSAFAPIIHAASIFPYSQLDQQSGLRYYFLEGVLILIGVGFYAAHFPESWKPKRYDVCGASHQIFHVAVVLGAIAHYYGIMSAFEWNYANQRCAW*


> Cochliobolus sativus (PQRA3A) JGI Genome

MTLLTCQGASKEEAGIVEGQTNGYGNYGTTSTQQQHDRFGKKRDRDQGLQSVGLNDEDELLEWDDLLHWQQDNEFILTKHRRATFSYQRSLRSVFQIHNETVNIWSHILGTAGFLYAMAALGLYMRELDRHAKDELAVLIYFISVIACFFFSFVYHIFLDHSQSTRTWTSRFDYLGIVVPLWGTTIASTHFGFRCEPDLRKTYTVFVTGAGLACAVTTLHPSFTGTASKGFRTVTYLLLGLSSFLPIIHGLHLFGWQQMEQRMSLSYYLALGLCHGTGAITYASKVPERWYLKRYDLVGSSHQIMHVLVVCGAVAYGLGVLKAREHWKGFNCAGLQ*


> Cochliobolus sativus (PQRB) JGI Genome

MARSNSSVGVSSAVMTSQEEPIQPSYRGYGTFASQRPAQRQRRHSWHTRPCMQEAENFQVLLRNFLAELNCRLDLLEDYGHLKYDAGVEYAYNTLLAVRESCSKISDGAIEAGRRQASVFVETLEERYKDALERKETLGEKVLEGIVLMDNYLTEFEARAFALGDASIGTYAHEFYEEGRRKMDEGIEIAKGVVDGGLDKARRARENIELRVEHAVQRALAQAKAHGLIQYEDLPEPWRVNPHILKGYRFQEGKWACVRSIFGLHNELINIWTHLLGFIMVLAIAFYFYPSSANFSMSTKADIFIAAVFFFAACKCLACSTIWHTMNSISHQTLLERFACVDYTGISLLVAASIMTTEYAAFYCEPVSRWSYMCITALLGIGGVILPWHPTFNRADMAWLRVVFYCSLALTGFLPFGQLAYTRGVAWAQYFYAPITKSLLVYITGACLYASKTPERFFPGLFDYIGCSHNIWHLAVLGGIVFHYMAMQTMFTQALTRAQTSCSVY*


Dikarya; Ascomycota; Saccharomyceta; Pezizomycotina; Leotiomyceta; Dothideomyceta; Dothideomycetes; Pleosporomycetidae; Pleosporales; Pleosporaceae; Setosphaeria; Setosphaeria turcica
> Setosphaeria turcica (PQRA1) JGI Genome

MDKVEEAASKVADASKTLEKRVEEKLILVWDELSPWQQDNHYIRSGYRAPSNSYSKSWKSLGYLHNETVNIYTHLVGALLAVVAGISLYIILEPRYETATREDVWAFGCYFAGAVACLGMSGTYHTIQNHSHEVAVWGNKLDYLGIVFLIWGSFVPVLYYAFRDEPELRKTYWAMITTLAAGTSVVSTHPKFRTPALRPFRALMFVLMGLSAVFPVLHGARLYGVQHLRKSIGLNWVLLQGVLYISGAAIYAARVPEKWSPGKYDIWGSSHQIFHVLVVLAAASHLVGLIQAFDYEHGQRVGEMKVALGSTGP*


> Setosphaeria turcica (PQRA4A) JGI Genome

MTSDLFRSDEVPPWYAHNTFILTAYRPVTKSTRLCVQSLAYLHNETVNIYSHLIPAILSLVVSHVFSRDFAERYPHASWKDEFMFRIFLTTCVICFGTSAAYHTLICHSRTFADLWVRLDYVAIVVQIVGSFIPGLYFAFYCEPNLQKLYWTMIVSLGALTATVVLNPSFQGPKWKRLRLSTFVATGFSAFAPIIHATSIFPYAQLDQQSGLRYYFLEGFSILVGVGFYAAHFPESWKPNRYDICGASHQIFHLAVVAGAVAHYYGILTAFEWNYQNQRCRW*


> Setosphaeria turcica (PQRA3B) JGI Genome

MIPSPFLRGMRYVRLHPETYLRLSNQICSRLVPRRDNEYILSSYRVVSRSYKRSLESIWCIHNETANIYSHIIGSVIFFALPVPVYYYLEPRYANASTADMVVFSTFFFGVAICFALSAAFHIFNNHSESVHIFGNQLDYLGIVILMWGSTIPCVYYGFYCTPNLQQTYYTLVSVLALGCVYATLHPAFRRPRYRPYRAAMYAGLGLSFVIPIIHGIKRFGWETQMWRMSLDWMALMTTFNLTGGALYAMRIPEKWYPYRFDVWGASHQVMHCLVVCAGIAHLFGLLRAFDHVHGHGNICAP*


> Setosphaeria turcica (PQRA3A) JGI Genome

MTSHVRQDARENAGIAQGKNRGNGYGATSTSWHLAGKTCPVNGNLPKGEHDLIEWEDLLHWQRDNEFIPSSYRRATFSCYRSLQSVFRLHNETVNIWSHILGTIGFLCALGVLVVFIQREDVESADHLAVLIYFISVIACFFLSIVYHIFLDHSQYIRTWTGRLDCLGIVVPLWGTTIASTHFGFYCESTLREGYGIAATIAGLACAVTTLHPSFCGPASRRFRTAMYLLLGLSSFLPIVHGICLFGLGQMEWRMSLSYYLALGLCHGTGAMAYATRIPERWTPRRYDVVGNSHQIMHLLVVCGAVAYGLGVLKAQQHWAGLGCANVV*


> Setosphaeria turcica (PQRB) JGI Genome

MPRSKSSVGVSSAVMTSQEEPVQPTYRGYGTFAAQRQRRHSWHTRPCMQEAENFQLLLCNFLTELNCRLDFLEDYGHLKYDAGVEYAYNTLLAVRESCSKISDGAIEAGRRQASVFVETLEERYKDALERKETLGEKVLEGIVLMDSYLTEFETRAYTLGNGSLGTYAHDFYEEGLRKMDEGIEIAKGVVDGGLDKARRARETIELRVEHAVQRALARAKANGLIHYDDLPEPWRVNPHILKGYRFQEGKWACVRSIFGLHNELINIWTHLLGFVMVLAIAFYFYPSSTNFSMSTNADIFIAAVFFFAACKCLACSTIWHTMNSISHQTLLERFACVDYTGISLLVAASIMTTEYAAFYCEPVSRWSYMCITALLGIGGVILPWHPTFNRADMAWLRVVFYCSLALTGFLPFGQLAYTRGIEWAQYFYAPITKSLLVYVTGACLYASKTPERFFPGFFDYVGCSHNIWHVAVLGGIIFHYKAMQAMFTQALTRAQTSCSVY*


Dikarya; Ascomycota; Saccharomyceta; Pezizomycotina; Leotiomyceta; Dothideomyceta; Dothideomycetes; Pleosporomycetidae; Pleosporales; Leptosphaeriaceae; Leptosphaeria; Leptosphaeria maculans complex
> Leptosphaeria maculans (PQRA1) JGI Genome

MSTAVDSAKQALSDVTKEAQTLEKKVEEKLTLLWDELAPWQQDNHYIHSGYRPQSSSFYKSFSSLSYLHNETVNIYTHLIGALLALFASGILYSVLAPRYESATREDVYVFACYFAGAVVCLGMSATYHTIQNHSHEVAVWGNKLDYLGIVALIWGSFIPITTLAAATSIACTHHKLRTPALRPFRALMFALMGLSAIFPVIHSIRLYGIEHMRKSIGLDWVVLQGVLYLLGASIYAARVPEKWSPGKFDIWGSSHQIFHVLVVLAAASHLVGLIKAFDYEHSHRIGVLGAGIGRKVW*


> Leptosphaeria maculans (PQRA5) JGI Genome

MDSKTSKPVYVPATTRREDAPPWMRGDQYIKTGYRRQLCSAHRCLLSLLYLHNEFVNVWSHLIPGIIHTLLLARECREFAKQWDEERYMDQMIVWQYILSCILCLLFSAGFHTLTAHSHTTATRWLKIDYLGIILNTAAGCTASTYFGLRHHPTLQLSYITSSALLALILFSIMLAPGADGEAMKIWRSVLFATFFASGFVPMLHACIIDGVEVLGLFPLAHALGMGACYGTGVVFYITRFPEKYYPEKFDIWGASHQIFHVVVVMGQITFITGLRQMVAAFSPVSAQIAQEAGIGDWGFGRGEVVANVCLNDALWAP*


> Leptosphaeria maculans (PQRB) JGI Genome

MSRTLAMPPRSQSSAAVSTAVMTSQEEPSRTTYRGYGTFDSRHRRHSWHTKPCAHEAENFHILLRNFLTELNCRMDFLESYGHLKYDEGIEYAYNTLLAVREQCSKISDGAIEAGRRQAAVFVETLEDRYKDALERKETLGEKVLEGILLMDSYLTEFESRAHALRDGTIGSYAQEFYEGGRRKMDEGLEIAKGVMDGGLDKARRAREAIEYTVEHAVQKALQRAKEHGLIHYDDLPEPWRVNPHILKGYRFSEGKWACVRSVVSIHNELINIWTHLIGLVMVLAMAFYFYPMSHNFSISTKADIFIAAVFFFAAVKCLACSTIWHTMNSISHQTLLERFACVDYTGISLLVAASIMTTEYAAFYCEPVSRWAYMGITALLGIGGVLLPWHPTFNRSDMAWARVLFYCSLALTGFLPFGQLAYTRGLAWAHYFYAPLAKSLAVYVTGACLYASKTPERFFPGFFDYIGCSHNIWHLAVLGGIVFHYTAMQTMFSAAMTRAQTSCSVY*


Dikarya; Ascomycota; Saccharomyceta; Pezizomycotina; Leotiomyceta; Dothideomyceta; Dothideomycetes; Pleosporomycetidae; Pleosporales; Phaeosphaeriaceae; Phaeosphaeria; Phaeosphaeria nodorum
> Phaeosphaeria nodorum (PQRA1) NCBI:XP_001798226

MDATKKAASDAIDEVVQTTKQAEKKLEQKLTYLWHEIDAWQQDNPSIISGYRPASNSYAKSFSSLSYLHNETVNIYTHLFGALSFLILSIVLYRTLGPRYATATREDVYAFSCFFAGAIACLGMSATYHTISNHSHAVARWGNQLDYAGIVFLIWGSFVPVLFYGFKSEPEIMRRYWAMITTLAACTSVVSMHNKFRTPALRPFRALMFVLMGLSAVFPVLHGIQLYGVAHMREAAGLDWVVLQGVLYITGAAIYAARVPEKWSPGKYDIWGSSHQIFHVLVVLAATSHLVGLLKAFDFEHGRRSGGVDGGSMHKVGL*
> Phaeosphaeria nodorum (PQRB) NCBI:XP_001794214

MQEAENFQVLVLDFLESYGSLKYDAGVEYAWTTLVNVRDSCSKISDGALEAGRRRAAVFVETLEGRYKDALERKETLGEKVLEGIILMDNYLTDFETRAYTLKDGTIGTYAHGMYEEGLRKMDEGFGIAKGVVDGGLDKARRARETIELTIERSVQHALARAKEHGLIHYDDLPEPWRVNPHILKGYRFSEGKWACVRSVFGLHNELINIWTHLLGFIMVLALAFYFYPTSANFSNSTKTDIFIAAVFFFAACKCLVCSTIWHTMNSISHQTLLERFACVDYTGISLLVAASIMTTEYAAFYCEPTSRWTYMLITAGLGIGGVILPWHPTFNRADMAWLRVLFYCSLALTGFLPFGQLAYSRGIEWAQYFYAPITKSLVVYMTGACLYASKVPERFCPGWFDYVGCSHNIWHVAVLGGIVFHYMAMQTMFTHALDRAQTSCSVY*
> Phaeosphaeria nodorum (PQRA3B) NCBI:partial EAT89584.1

MTSASLLTWDEIRSQSYRAVSQSYRRSIGSILGIHNETVNIFSHLIGSVLFLALPVPVYRSLKPRYNTATTADIVVFSTFFFGVATCFALSAMFHIFNNHSARVHVFGNQLDYLGIVILMWGSTVPCVYYGFYCTPALQKTYYSLVSVLAAGCVYATLHPAFRRPKVSRYRATMYAGLGLSFIIPIVHGISIFGWETQMWRMSLDWMALMTTFNLTGGALYAMRVPEKWYPYRFDVWGASHQIMHCFVICAGIAHMFGLLRAFDHVHGHGDICT*
> Phaeosphaeria nodorum (PQRA5) NCBI:XP_001805779

MSTASRPAAALTRFPTLLNHLKMQSKTEKAVTATTRQEDAPPWMRADQFIKTGYRRQLNSFYRCVTSLLYLHNEFVNIWSHLGPGIVHTLLLTKECHAFSKQWDEERYVDQMIVWQYIISCILCLLFSAGYHTLTAHSQHVAIRWLKIDYLGIIFNIVAGCTASTYFGLRHHPKLQLCYISSSVALALVLFSVMLAPGSDGDAKKLWRSVLFATFFASGFVPMVHASIIDGVEVLGYFPLAHTIGMASFYGTGVLFYVTRFPEKYFPEKFDIWSQGASHQIFHVVIIMGQITYITGLRQIVATLGPVSAQIALESGFVVTD*
> Phaeosphaeria nodorum (PQRA2) NCBI:partial EAT79566.1

MAQLHRPKARRKSTTQKISEVIQSTKRLLFTFDEVEAWQRDNEYLCGNYRTKSNSYRASLKSMLYLHNQTGNIYSHLVGAVLFLAYSTNVYDKITTRYSTADVFDLLAFGVFISSAIICFGISATFHIFGNHSSKVYHTWLMLDLYGIFVLIAGTVYSGTYYGFYCEQEYWIMYSVGVRSPFLVCTALSHAPHFRTPKWRWARAALFCAIGWSGAFPMTHAAQAFGVEQAHRQMGWWYFIWEGLSYISGAIIYALRIPERMRPGLFDIWGCSHQIFHVCAVVGAALHLVGLLQAFDYNHDPMTRRC*
> Phaeosphaeria nodorum (PQRA4) NCBI:XP_001801258

MPRFFSKRLAPAPALVPFDVLPDWYRDNPHILSAYRPVSNSFHACLQSLTYIHNESLNIYTHLLPAIVLAFALPTLQINISSIYAEAPWMDRFILTLTPMAALLTLSLSATYHTMMNHSRFVSASCLLLDYTGILALILASFISGIYVGFYDSPAHQRIYFSMIAVLVLTSCLFVLHPKLQGPAHRPHRTAAFIATALSGCAPVMHACLYYGTYEAFYYRGAMWWLAEGAWYGIGSWFFAKRWPECCTWAKEKGKGRFDVFGSSHQLFHCCVVAGAACHCWGVWWAWRCAV*
Dikarya; Ascomycota; Saccharomyceta; Pezizomycotina; Leotiomyceta; Dothideomyceta; Dothideomycetes; Pleosporomycetidae; Hysteriales; Hysteriaceae; Hysterium; Hysterium pulicare
> Hysterium pulicare (PQRA1) JGI Genome

MASTIFLTLRKPKLALQKAGPEAGQFQDAQEISPGHPRFPSLVAFDELPAWYQDNPQVRTGYRPVSNSFQTCIHSLTYLHNESLNIYTHLVPAVITVLALPTIQHLITIHYPTAPLTDRLVFTLNVLSALLTFCLSTTYHTMMNHSHPISSLCLLMDYGGILSLILSSFISGIYVGFYCEPFLQKVYWGMIVSLILITSLLVLHPRLQGPLWRGRRTTIFVLTALSGFAPIAHGLLKYGWDEMWARSGMPFWFLEGICYGTGAGFFSTRVPERLSWGRFDIWGSSHQLFHVCVVAGAVSHLWGVWSSWGAHLELWEC


> Hysterium pulicare (PQRB) JGI Genome

MACTSTALMAESYEEPVMRSSYGTFTREQKNRRRHSSYQPNHATPWTVDADNVQILVDRFLTELNCRLDFLESYGHLNIDAGIDYAYSTLLAVRESCSKISDGVIDAGRQRAWVLVKTLEERYKEALLTKDTMEQKVQEGVRLMESFLGDFESRAYAVRDAGIGSVAQDFIDGGWRRVDEGVGKAREVVDEGLVKARRARETIENAVESALARAREHGLIKFEDLPDPWKINPYIHKGYRFSEGKLDCLRSTVCLHNELFNIWSHAIGLIVVLAIAFYFYPMSVNFSLSSNADVIIAAIFFFAACKCLVCSTIWHTMNSISHQTLLERFACVDYTGISLLVAASIMTTEYTAFYCEPVSRWVYMLTTAALGIGGVILPWHPTFNRADMAWARVLFYVSLAATGFLPVFQLATTRGIDWAMYFYAPVTKSVLVYLTGAVLYASKIPECWFPGMFDYVGGSHNIWHVAVLGGILFHYTAMQELFAQAFLRAQMHCSVY


Dikarya; Ascomycota; Saccharomyceta; Pezizomycotina; Leotiomyceta; Dothideomyceta; Dothideomycetes; Dothideomycetes incertae sedis; Patellariales; Patellariaceae; Rhytidhysteron; Rhytidhysteron rufulum
> Rhytidhysteron rufulum (PQRA1) JGI Genome

MTLRKVPKRVSFSLPETEKKIEERLTVLWHDLPFWQQDNHYIQSGYRPQSDSYVKSAKSLGYIHNETVNIYTHLIGAVLAVISGSCLFSILRPRYDTATREDVLVFSCFFLGAFICLGMSATYHTISNHSPAVAIFGNKLDYLGIVFLIWGSFIPILYYGFQTEPHLIKAYWTMITTIAAGTAIVSTHPKFRTPALRPFRAIMFVLMGLSAIIPVFHGLGIYGLKQMRKSIGLDWVVLQGVLYILGAGIYAARFPERLRPGKFDIWGSSHQIFHVLVVLAAAAHLVGIVKAFDYEHSRREEPVYLEFLHGLWGSD


> Rhytidhysteron rufulum (PQRB) JGI Genome

MRSSYGTFTREQQRRRRHSSYHTHHERPWTVDSDNVQILVDRFLHELNCRLDFLESYGHLNIDAGIEYAYSTLLVVRESCSKISDGMLESGRERASIFVKTLEERYKEALATKDTLEQKVQEGLRLMETFLGESEARAYAMRDAGIGGMAQDILDGGRRRVDEGVERAKGVMDEGLGKARRAKETIEHAVERALASAREHGLIKFEDLPDPWKINPYILKGYRFSEGKLDCLRSTVSIHNELFNIWSHFIGLIIVLAVALYFYPSHVNFHVSTNADVVVATIFFIAACKCLVCSTIWHTMNSISHQTLLERFACVDYTGISLLVAASIMTTEYTAFYCEPVSRWVYMLTTAALGIGGVILPWHPTFNRSDMAWARVLFYVSLAATGFLPVFQLATTRGLGWAVYFYAPVTKSIVVYLTGAIMYASKIPECWFPGMFDYVGCSHNIWHLAVLGGILFHYTAMQELFSQAFLRAQTQCSVY


Dikarya; Ascomycota; Saccharomyceta; Pezizomycotina; Leotiomyceta; Dothideomyceta; Dothideomycetes; Dothideomycetidae; Capnodiales; Mycosphaerellaceae; Mycosphaerella; Mycosphaerella fijiensis
> Mycosphaerella fijiensis (PQRA1) JGI Genome

MAGFESEKTSASSSNALQTGETRAEKALTILWSQLPEWMQDNQFIHSGYRPPSNSYARSAASIGSWHNETINIWSHLIGALLAGSAGTKLYFSIRPRFEMATTEDVMVFSCFFLGAVACLGMSATYHTISNHSHAVAKLGNRLDYIGIVFLIWGSFIPSIFYGFSAEPHLINLYWSMITTIGAGTVLVVLHPKFRSPSWRPFRAFMFVMMGLSAVFPVLHGLSIHGWAEVEQRIALSWLITQGLLYIIGAMIYAARVPERWKPGAFDILGSSHQIFHVLVVAAAAVHLKGLLKAFDHEYGVRTESSYPGVGR*


> Mycosphaerella fijiensis (PQRB) JGI Genome

MTQTYCTARSTYSSTATATESYEEPTVGTSSGTKFDLDQERARKRRRHSSYNPRSWSTERENVQILVDQFLSDLGRRLEMVEQYGHLKFDESVKSLHETLREVHERCSRTRDDILDAGRRRHKILVETLESNYRDALAKRDTLEAKVQAGIKMLEENLAALEQRAYHIRDVGLGVTASEMLDSSIAYMDDKATKAGQMMHEGADAAWRAKERMKMKIETALAHAKKHGLVPYEMLPEPWRVNPYILSGYRFSETKVHCITSCFRLSNEFVNIWSHAIGLIIVLALAFYVYPSTPAFTSATKFDIFIAGCFFFAACKCLVCSCMWHAMSSISNQTLMERFACVDYTGISLLVAASIMTTEYTAFYCEPISRWIYMSLTFVLGIGGTIVPWHPFFNRADMSWARVAFYVSLATTGFFPIAQLTYERGWHETAYFYAPIAKSILVYLGGAILYAAKIPERFLPGWFDYAGGSHNIWHIAVLGGILFHYSAMQSFFGEAFRRASMSVDGCSTY*


>Mycosphaerella fijiensis (PQRA4B) JGI Genome

MASAPRLRNPPPPDPHKGTEMESPSDNTPLVRKSGRPVLLSFDEMPEWFRVESNKWILRGYRPISGSIQVSFNSWTYLHNESANIYSHLLPAVFFLLGEWYIQQYLTNRYSLVTGADFIAFSIFMLAAVTCLSLSATYHTLLNHSQHVEHFCLRLDMLGVVIFILGDLILGIYVVFWCEPVPRNIYWSMIALFGSLTIFMTMHPKFQGAKYRFFRAMMFVATGLCGVAPLIHGINVFGMTQMMRKAFPYTMAKAGCLLSGTGFYATRFPESSYPGKFDLWGSHTIFHVLVVCAAVVQLMGYLDAYEYAQTTLTCSSS*


Dikarya; Ascomycota; Saccharomyceta; Pezizomycotina; Leotiomyceta; Dothideomyceta; Dothideomycetes; Dothideomycetidae; Capnodiales; Mycosphaerellaceae; Mycosphaerella; Mycosphaerella graminicola
> Mycosphaerella graminicola (PQRA1) JGI Genome

MSTKSSKVKKEEESSTLLQQTEKKVSQALTILWNDLPHWMRDNHYILSGYRHPSNSYAGSISSIFSLHNESVNIWTHLLGSLVAFVTASILYFTVLPRFHLATSEDVVVLGCYFFGAVVCLGMSATFHTISNHSEAVQKFGNRLDYIGIVVLIWGSFIPSIYYGFSAEPGLVRVYWSMITTIGAGTLVVVLYPKFRTPEWRPVRALMFVLMGLSAVIPVVHGVSKYGYAQMEQRMGLSYAIGQGVLYIVGAAIYAGRVPERFNPGAFDIWGSSHQIFHVLVVMAAVTHFVGLVKAFDNEHSARTLVGFVEAKGLLPWS*


> Mycosphaerella graminicola (PQRB) JGI Genome

MTQTTYCTRTTSATATSARQRRRHSSYNPRSWSSERENAQIAMDGFLSDLGRRLEMLETYGHLKLDEGVKSVHETLRHVHDRCLHVSDDILDAGRRRSKVLVDTLESHYRDALTKKDTLEQKVQEGVKMLEYSLAALEQRAYHMRKAGLTATAHGMIDSSIAYMETGAFKASEIVSEGAEAARRAKEALKAKVDAAIVHARQHGLISYEMLPEPWRVNPHIKNGYRFSETKLDCIRSCFTISNETFNIWSHALGLVIVLALAFYVYPKTPAFTSATRFDIFIAGCFFFAACKCLVCSTMWHAMSSISNQTLMERFACVDYTGISLLVAASIATTEYTAFYCEPTSRWIYLSTTLVLGIAGVILPWNPTFNRADMSWARVGFYVTLAATGFVPVAQLTYQRGLAATLYFYAPIVKSIAVYLGGAILYAAKVPERFLPGWFDYAGGSHNIWHMAVLGGIIFHYYAMQSFFGEAFRRAEYGCSLY*


> Mycosphaerella graminicola (PQRA4B) JGI Genome

MDSTSDTTIKASKAGRPVLLSFADMPDWFQRDNNKWILHGYRPISGSVRISFRSWSYVHNESVNIYSHLIPAALFLFGEWGVQQYLTQRYPGVAAADRIAFSIFMVAAVTCLSLSATYHTLLNHSQHMEHVCLRLDMLGVVIFILGDLVLGIYVIFWCEPLPRIIYWSLVSIFGTLTIVMTLHPKYQGNKYRTFRALMFVATGMCGVAPLIHGFFAFGTSQMMRKAFPYTMAKAGCLLSGVSFYATRYPESSYPGKFDLWGSHSIFHVLVVCAAVVQLVGYLDAYDYAHAYLTCSSP*


Dikarya; Ascomycota; Saccharomyceta; Pezizomycotina; Leotiomyceta; Dothideomyceta; Dothideomycetes; Dothideomycetidae; Capnodiales; Mycosphaerellaceae; Mycosphaerella; Mycosphaerella pini (Dothistroma septosporum)
1   2   3   4   5   6   7   8   9   10


Verilənlər bazası müəlliflik hüququ ilə müdafiə olunur ©azrefs.org 2016
rəhbərliyinə müraciət

    Ana səhifə