If no accession number is given or only a partial protein sequence is found in the database then the protein sequence was derived from genomic sequence. Grey shading indicates genomes that are complete according to ncbi




Yüklə 371.95 Kb.
səhifə10/10
tarix23.04.2016
ölçüsü371.95 Kb.
1   2   3   4   5   6   7   8   9   10

> Wallemia sebi (PQRA) JGI Genome

MRRRATKEEVNKKSTKPNGLLTYNDIPEWMKDNNFITHGYRPVSHSVKQSLRSIFNSIHNESLNIHSHLWGAIFFLLALVAISTDTFHRKHPNYGWKDYLGFTIFILSAITCLSFSFLYHTFSNHSKEFANTWHALDYAGICILIAGSFVPCLYYGFYCSPAFQIFYIASMLIASSVALYIVLHPHYRRPAFRKARTTVFIALGLSGILPITHAIANDGLGVMRTMALDYVVLSGMMYILGATIYACRFPEAYLSHKFNFSYVGASHQIFHFFVVAAAVCHYLAIRSSQSFYGDPEFDYCHAYR*


> Wallemia sebi (PQRB) JGI Genome

MSEGGIRRRASYSSNIKSFLPSEIASHLPSATSSALDYLDLHGTVDAVWSAGERLQRCFFDVENRVKTFVESNPTSISKDLLKMLTDLRTMDIEKLRLPSVQSQIEYITVKLKSVMASSPDQVVLDKWDEIRRLVEEEFQDKAQLFDSVVEHSFDSAKKSIERALIRAQNGAKLIKFNELPDAWKNNEHILTGYRFIPIDNKRDLFLSAFKWHNETINVQTHLWAAVGVTMLLLYHVVAPHPVWIAEDSTWSDKLVMVSFLLASLKCLIFSSLWHIHAGCADKKYFEHYACVDYVGISSLITASITGVTFYGLYCDNITRNTLLTFIISNAFVGSYLPFTDSFNKKESRGFRIGFFVYMAICGLAPILAMVSYHGLDNTLTFLAPIIPSLLFYVVGLIIYAFQIPECFAPGRFDFAFASHNAWHIAVAAAIFLHYKAIVSMYESRYLFAC*


Zygomycota; Mucoromycotina; Mucorales; Mucoraceae; Mucor; Mucor cincinelloides
> Mucor circinelloides (PQRA) JGI Genome

MAIQQRNTSQAINSDIQKQHDGQGRDTDRLLPNQSEKLILSWNEIPAWMQDNVYITGGYRRQTNNYWDCVKSLGYLHNESVNIWSHLLTFILFVGFGIHFLWTQPFQETLTTFDITYFFLFIAGALLCLGFSASFHCFSCHSEKVAATWNRCDYAGITCLIVGSFFPVIYYGFHCHHILQVVYLSIIVSLGSVTAAVTLMKHFRTPAYRWIRASLFMALGLFGLIPTFHGIWIYGLNNATKTIALGHMALMATTYIAGALIYGCRFPERVMPGKFNIFGASHQIFHICVTIAVLAHYFGVMSAMAFWHDVSNEEFCQTLFF*


> Mucor circinelloides (PQRB1) JGI Genome

MEELDGKIADALGRADKMRERVEEKLMVVAGVANDHIDKLKYAMSFGANRLLMYDELPGPWQSNEYIRTGYRFLDSAADCWYSLFYVHNETGNIWTHLLGFVALFSVGVYELFFSELMTSIPVQDRLIFLVFFLAACKCLMCSTVWHTLSGINNLKVYRQVACLDYVGISVLICASIMLCEYYGFYCNDAVRNTYMTATTSLAVIGVSMPFQAWFDKHERRWLRIAFFIALASSGAIVIGHLAVMRGAIETFAWLTPVFKSIACYLAGVILYGNQFPERFWPGKFDHFGHSHQFWHLFVCGGIWFHYQAALQFASNREIFGQCQLI*


> Mucor circinelloides (PQRB2A) JGI Genome

MAPPQMAEQPLLGDDLLSDQSNLHLRRYSQSHVISASSAQDSITVPYTRGRSFSTSVVPGSSLAAQILATVNNKLKTKDEYDDPSFLEYMDGQIHETWDTAKALMLGSKRLLLIEELPKDRQENQYVLSGYRFYRNSKDCLRSLFTLHNETMNIWSHLLGFFFFLYLSVNVFQRKFPDASTPDLVMFTAFCLASLTCLLCSSIYHTFVCHSAHHIKSFTATLDYIGITFLITASISMVVHFGFYCDPIPRSRYMLFSCLIGSIGVILPFFRFFDTKRYRPLRIGLFVAMAFSSVVPLLHLTTVKGTIATGAFLKPALLGALMYICGVIVYGKRFPEKFFPGRFDAAGMTSHAIWHVFVCLGIFFHYIGSFHFYNLREEYGCMLN*


> Mucor circinelloides (PQRB2B) JGI Genome

MKSTNRHRKQRPPSSPKCQKRARSQSITDTISEKFKEIEQADATGFLQYMDDQVHDTWDNAKAAMVGAQRLLQFHELPKEWQENEYVLTGYRFYQSSNACLRSIFMLHNETMNIWSHLLGFIFMSCLSIYGFNSHFPDATFNDRTVFMTFCIAALKCLFCSSIYHTFICHSHRQVKSFTATLDYMGISFLITASVLVTEYYGYYCRPMMKSRYMVFTTIVGSVGVLAPFLPKWDTKALRPLRIAVFVSMAVSSAVPVFHLVYLNGFKSTWHFFELAAVSVAMYILGVIVYANRFPEKFFPGRFDFAGLTSHAIWHVFVCLGIFFHYLASLRFYANRYTYGCNMISRN*


Zygomycota; Mucoromycotina; Mucorales; Mucoraceae; Phycomyces; Phycomyces blakesleanus
> Phycomyces blakesleeanus (PQRA) JGI Genome

MRESIEDEVTPLETLDSVKDTAALLGDQPRFGKTVSWSDLPAWLQDNVYITDGYRPPMPNYKDCFNSLFYLHNESVNIWSHLLAFFVFIGLGISFLWNQPFADSLTRFDYAYFFAFIIGALVCLGFSSSFHCLSCHSEPVAAAWNRCDYAGITSLIVGSFFPIIHYGFHCHTRIQTFYLVVITVLGSFTAAITLMKHFRTPAYRWIRTSLFLALGLFGVVPTLHGIYIYGFDRAIHTVSLANLLLMAVSYVTGALIYGHRLPERYYPGTFNIWFASHQIFHIFVVIALISHYLGVMKAMEYWHKHGNNVCLDFQ*


> Phycomyces blakesleeanus (PQRB1A) JGI Genome

MDSLKNAIAYGAKRLLHYEELPEQWQNNKHIHTGYRFLSTPADCFHSLLYVHNETGNIYTHLIGFFVFFVLGVYELFYSPLLSEVPGLDRVVFAIFFLAACKCLMCSTVWHTLSAINNYETLTKMACLDYVGISVLICASIILTEYYGFYCEPMWRNTYMAGTGTLAMIGVVLPFMSWFDRKDLRWIRIAFFIFLASSCVLPVAHLVYEYGTDETFSWLMPVAKSLSCYGLGVVVYANHLPEAFWPGKFDHFGHSHQLWHIFVCGGIWYHYTAAVAFVGHRGQFGQCIANF*


> Phycomyces blakesleeanus (PQRB1B) JGI Genome

MADLASDHMDQIKGAVANGAKRLLHYEELPIQWRNNEHILTGYRFLNSTAECWHSLLYVHNETGNIYTHLFGLVFLAMVGTYHLLYSPVLSDIPLSDKVFFGVFFVAACKCLLCSTVWHTLSGISDLQTYRKVACLDYVGISVLICASIILCEYYGFYNHDIWRNTYITATGSMAILGVAMPFMSWFDHSERRWLRTMFFVVMASSAVVPIIHLCIANGLQETANFLSPFSKSISSYIIGVIVYSNQLPERIWPGKFDHFGHSHQLWHLFVMGGIWFNYTAIFHMVNLRETYGQNNILNTTTTTTTTI*


> Phycomyces blakesleeanus (PQRB2B) JGI Genome

MYPASLPRRHSQSFAVTTSMAGTLTHPHQRTRSHSTSLPCRPVLASHLIASVNSKIKEIEDADTTGFLRYMDDQVTETWDTAKAALVGAHRLLQFHELPAEWQENEYVHSGYRFYQSSRACLRSIFMIHNETMNIWSHLLGFIFFACLSVYGFHSHFPGASFNDRTIFMTFCLSALKCLFCSSIYHTFICHSRHTVKSFTATLDYMGIAFLITASVLVTEYYGFYCKPSIQARYMVFTSIVGSIGIFTPFLKCWDTREYRPLRIAVFLSMAISSSVPVFHLFLMNGFGPTWSFLKLAAVSVAMYVFGVCIYVNRFPEKMYPGRFDFAGMTSHAIWHIFVCLGIFFHYLASLNFYANRYTYGCLLKGA*


Zygomycota; Mucoromycotina; Mucorales; Mucoraceae; Rhizopus; Rhizopus oryzae
> Rhizopus oryzae (PQRA) Broad Institute GenomeIPVWMQDNVYITGGYRRQTNSYQKCIESLFYLHNESVNIWSHLLAFILFVGIGVYFVWSQPYVDTLTTFDYSYFFIFIAGALTCLGFSASFHCFSCHSEKVAATWNRCDYAGITSLIVGSFFPVIYYGFHCHQTLQGIYLAIIVVLGIITAVFTLAKHFRTPAYRWVRASLFISLGLFGVVPTAHGIYIYGLSNALRTISLGHLILMAVTYILGALIYGFRFPERMKPGAFNYFVASHQIFHICVVVALLAHYLGVLSAMAFWHNPVNLSFCIKLMSIKNA*
> Rhizopus oryzae (PQRB1A) Broad Institute Genome

MENLLTLQPRTVLRHDESLQVFFKDNLEPLIKKFKYRLSQFEIAVVSSENYTLSKINDAYHLLERLGQEWERALEATKNDCVLASPDLMSAMSELSKKYHELEDMNNSERLENAIDAFMIKIEELDGKISDALGRADKMRERMEEKFHEVAEVANEQIDKLKEAMTFGTKRLLHYDELPAPWQSNKYIFSGYRFLNTAADCWYSLFYVHNETGNIWTHLLGFICLLSIGIYEFFYSDLITNVPITDRLVFMIFLLAACKCLMCSTVWHTLSGINNLKIYKQVACLDYVGISVLICASIMLCEYYAFYCDDAIRNAYMVATSSLAILGVIMPFQSWFDHHDRRWLRIAFFIALASSSAIIIIHTSLVRGVFQTFGWLTPVFKSLGCYVAGVIIYGNQFPEKFWPGRFDRLGHSHQFWHLFVCGGIWYHYQAALQFASFREEFAQCSA*


> Rhizopus oryzae (PQRB1B) Broad Institute Genome

MENLLSIRSRTVLHHDDSLDFEVFFKDKVEPLMKKFKYRLSQFESAVVSSENYTLTKINEAYRLLENFAQEWEQALEDTHKRISLEKDNDLMSAVTELSKKYHELDNLNNRDMLDNTIDAFMIKMEELDGKISDALGRADKMRERVEEKLYEVAEVANEQIDKLKDAMSYGTKRLLMYDELPTPWQNNKYILTGYRFLNTAADCWYSLFYVHNETGNIWTHLLGFIILLSVGIYEFFYSKLMSNIPIKDRIVFLVFLLAACKCLVCSTVWHTLSGINNLKIYKQVACLDYVGISVLICASIILCEYYAFYCDDAIRNAYMIATSSLAIMGVSMPFQAWFDNHERRWLRIAFFIALASSGAIIIVHLSFVRGMFQTFGWLTPVFKSLACYVAGVVIYGNQFPEKFWPGKFDKLGHSHQFWHLFVCGGIWYHYQAALQFASSREDFAQCTLKQLWYLLKSSEGFMNILW*


> Rhizopus oryzae (PQRB2A1) Broad Institute Genome

MNEICEVTRALLLGSRRLLLIEELPKDRRENQYVLSGYRFYQSKHDCLKSLFKLHNETMNIWSHLLGFVFFSFLSIHLFKRKFPEASQPDLLIFTAFCLASLLCLLCSSIYHTFICHSAHHVKSFTATLDYIGITFLITASISIIVHFGFYCDPTSRNRYMIFSSLIGSIGVILPFFRFFDTKRYRPLRIGLFVAMAFSSIVPLLHLVTVKGLVDSFEFLKPALTGCVMYICGVTVYAKRFPEKFFPGKFDFTGMTSHAIWHIFVCLGIFFHYIGSFHFYNLRESYGCMLN*


> Rhizopus oryzae (PQRB2A2) Broad Institute Genome

MAPPEIAEQLYFDEDDSNSRYSQSHLVSISSSTKDNLTTPHHRSRSFSTSSVDPSSLAVHIISSVNNKLKKEEHTMNEICEVTRALLLGSRRLLLIEELPKDRRENQYVLSGYRFYQSKHDCLKSLFKLHNETMNIWSHLLGFVFFSFLSIHLFRKFPEASQPDLLIFTAFCLASLLCLLCSSIYHTFICHSAHHVKSFTATLDYIGITFLITASISIIVHFGFYCDPTSRNRYMIFSSLIGSIGVILPFFRFFDTKRYRPLRIGLFVAMAFSSIVPLLHLVTVKGLVDSFEFLKPALTGCVMYICGVTVYAKRFPEKFFPGKFDFTGMTSHAIWHIFVCLGIFVS*


> Rhizopus oryzae (PQRB2B1) Broad Institute Genome

MRSTAFSTATSSDSKARSRSHSISSHILSSVNKKIKEIEDADSTHILQYVDNQVHETWDSTKAAMIGAQRLLQFYELPKEWQENEYILSGYRFYQTSQACLKSIFMIHNETANIWSHLLGFIFKSHFPDASWSDRTVLITFCVASLKCLFCSFIYHTFICHSHRQIKLFTATLDYMGIAFLITASVLVSEYYGYYCRPVMRNRYMLFTSLIGSIGIFAPFLKQWDTKEYRPLRIAVFVSMAVSSAIPVLHLIFLNGFKSTWNFFDLAALSVLMYILGVVVCANRFPEKMYPGSFDFIGLTSHAIWHVFVCFGIFVS*


> Rhizopus oryzae (PQRB2B2) Broad Institute Genome

MLSSVNKKMKEIEQEETLLQYVDDQMHETWDSAKAAMIGAQRLLLFHELPKEWQENEYVLSGYRFYQTSQACLKSIFMIHNETANIWSHLLGFLFMSWLCIYGFNCLFCSFVYHTFICHSHRQVKLFTATLDYMGIAFLITASVLVSEYYGFYCRPLMRNRYMTFTLLLGSVGMFAPFLKRWDTKQYRPLRIAVFVSMAVSSAVPVIHLYCLNGFKSSCEFFDLAGLSVLMYILGVVVYANRFPERMYPGEFDSIGLTSHAIWHVFVCFGIFVSILIQPLSF*


Chytridiomycota; Chytridiomycetes; Chytridiales; Chytridiales incertae sedis; Batrachochytrium; Batrachochytrium dendrobatidis
> Batrachochytrium dendrobatidis (PQRB) JGI Genome

MHTDYRPVAYKRPRSGNPTNESFSTSSSATTSLTSESSSIRVRKSTMAHSLTERAVSLDSTTTLTHSMSGLFKDDAEKRHQEHETAQMLPWWSSNRLVYYGYRAHQTYKEAWISTLHLHNETGNIWTHLAPFFIAMTGMILHLIYYDLHPNATYADYIAISVYLGCAAYTFITSSLFHMHLGVSPTVFIFFGCLDYSGISASIFGGSATTAYYFLYCDPNARIGWISALVVVNLVGIIGPIFKFWSGASFRAGRAIVYLSSGACSCAPIMYYLAIHGVKNLPSIHTSFAIPGILLMLFLYTFGVIIYVFRIPERFAPGFFDLAFHSHMNWHIFVMAACWMLYAALLDMMKWRLAPNHTCEA*


> Batrachochytrium dendrobatidis (PQRA) JGI Genome

MDQVAHDENALFYDSQQDTVSSLFHSRMVNGATESEKGRQVSVHDETLIDETGVLHTTAHDGSIQHARRRPQPLNISKTRRSSDGHSTVSTSNDKLTTGTTAAHSVANMGLALYENAVHALTTTSFTGLDEELMSSPRILRERRIMEYNVSEPDKSINDSISPVSNSKHINESKYRLSPPSLIPVMMQPSCVAKDELLASDLMNRHDMMADHDNDTPHRDASQDTLLSPPCLSSPHLIDHNRVHASWTDYDVYAANPTTNCINQYCVHARHMPSWYNDNAFIYLGYRRITNSYAGCLKSLFYLHNETGNVYTHLIGVVLFFVVVVIGIVNGINVSSWNQITENDLHKSDGLEPNVLIPHTVDLLLGTSRPSQQWLWKDAMVFGVFYAGAITCLALSTIYHLCCCHSRLVLVMWNKADYIGIVALIVGSFVPTIFYAFYCYPFWQILYLSIFTLMGFGTIFVSLMKQFSSPKYRFFRTSIFAVLGVSGAFPLLHAASMHGARTLYHTVSFPLLHAASMHGARTLYHTVSFDYIITMGGMYLLGAFIYAYRIPERWFKNMFDIWGHSHQIWHCLVLGAAWIHYCAVVRMFEWRSLHDPSCAHVSL*


Microsporidia; Unikaryonidae; Encephalitozoon; Encepalitozoon cuniculi
> Encephalitozoon cuniculi (Hly3) NCBI:NP_585907.1

MAKQKPMLRGRIHQIAFYLTIGKALMYGICCLHGKGNLGIMIYLLSQLILFGVSSTYHITSWKDEKTKALFQRLDHISIFLLISGTQTSVALLLLPEGPYTKHILMTTWTISLAGILKIILMKKLHMYFDLMVYILHGVSVVPFFHIIMKSVPVSDISLFILGGVIYIVGGLIYGMEKPNPYPQVFGYHEIFHVMTVLANWCFLIPLLREYISTLSGK*
Microsporidia; Unikaryonidae; Encephalitozoon; Encepalitozoon intestinalis
> Encephalitozoon intestinalis (Hly3) XP_003073112.1

MTKPKPMLRGRIHQIAFYLTIVKTFLYTICCFHKKGNFGIMIYLLSQLILFGVSSTYHVTSWKDEKIRSLFQRLDHISIFLLISGTQTSVILTLVPVGTYTKYALLMTWTISLAGILKIVLMKKLHLHFDLMVYILHGISVIPFFRIIASSITVGDTSLFILGGAIYIIGGLIYGIEKPNPYPQVFGYHEIFHVMTVLANWCFLIPLLKGYISTLSGK*
Microsporidia; Microsporidia incertae sedis; Antonospora; Antonospora locustae
> Antonospora locustae (Hly3) NCBI Genome

MLEKKPKMRGKVHQAAFIVTCCFAVVYVALWMSKGWTTGVAVYILSQLVLYGVSSLYHLKDWKTEKHRRLLQRIDHASIFLLISGTQTSVALLLLPIAEATKNMLVITWTISGLGILKVMFLKSIYETLDVVIYVIHGMSVVPFFKFLIRNTTLSDVILFVCGGVLYILGGIFFRIRKPDPFPSIFGYHEVFHVFTVAANICYMIPIFKKYLSML*


Microsporidia; Apansporoblastina; Nosematidae; Nosema; Nosema ceranae
> Nosema ceranae (Hly3) NCBI:partial EEQ81187.1

MEEKKPYFGGKIHLAVFYFTISKSILYILTWTLIKGNKAILIYLISQLILFGVSSTYHTTTWKNERAEYLVRLIDHISIFILIYGAQISVVILLLSYAIMSKTIIMISWTITLIGTLKIVLFRSLNHIFGTLVYILHGIPVVPFFKIIKVSVNTLDLTFIVMGGIVYVLGDIVYGYKKPDPYPFVFGYHEIFHVTTVLANYCFFIPMFKQYVTTLKEMETVYIFY*


MSKTIIMISWTITLIGTLKIVLFRSLNHIFGTLVYILHGIPVVPFFKIIKVSVNTLDLTFIVMGGIVYVLGDIVYGYKKPDPYPFVFGYHEIFHVTTVLANYCFFIPMFKQYVTTLKEMETVYIFY

Microsporidia; Octosporea; Octosporea bayeri
> Octosporea bayeri (Hly3) NCBI Genome

MLQQKPLLRGRIHQLAFYITIILTLFYITISLIKSYKYELTLYIIGQLTLFGISSKYHLTDWKNEKTKKIFQKLDHISIFLLISCTQSSFVLTLLPKIEIVNKILILTWTITLLGILKIICISNEYEIIDVSLYMIHGVSIVPFFHILLKYINISKMFYLVFGGVFYIMGGVVFGMHRPDPFPSVFGYHEVFHVLTVIANTCFMIPLLQWYYGVING*


Microsporidia; Pansporoblastina; Pleistophoridae; Vavraia; Vavraia culicis
> Vavraia culicis (Hly3)

MQKKPVLRGRIHQLALIISFIFLILHLLYSLFTQLHLGTLIILTTQCILYGTSSYYHLTSFKHTRTERLAQRIDHMCIFLFIASVHSSMALTLKLMHTKLILMTTWMIFVLGATKIFLVEKVVEAIDVALYIVHGMSITLFLKFESLRSVYRMVLSLGGLLYVLGGIVFGLEKPDLVPAVYGYHELFHTLTVLANVCFLIPIIMFYVSW*


Microsporidia; Microsporidia incertae sedis; Nematocida
> Nematocida parisii (Hly3)

MNIETISKEKERSIEQILTPNKSNSIIGAKDNPNVNENIDQEDSSSGYFTYPNSKPYCRGRIHQVAFYLTIIMYIVLMCTLRINKIYLSLYFASQVLLYGISGTYHTKKWKTRESEKLFQKLDHSSIFLLIAGTQTCVIAAINEVNIGGTSNILLYLPISYILAILGMLKVFFIQNIPKSVNVSYYIVHGASVIIFVPIEYVKKELPLFVFSIFGGVSYIIGGIIYGTKKPDPWPKTFGFHEIFHTLTVIGNTFFMLTIVWADYKA*GRMIG
1   2   3   4   5   6   7   8   9   10


Verilənlər bazası müəlliflik hüququ ilə müdafiə olunur ©azrefs.org 2016
rəhbərliyinə müraciət

    Ana səhifə