If no accession number is given or only a partial protein sequence is found in the database then the protein sequence was derived from genomic sequence. Grey shading indicates genomes that are complete according to ncbi




Yüklə 371.95 Kb.
səhifə1/10
tarix23.04.2016
ölçüsü371.95 Kb.
  1   2   3   4   5   6   7   8   9   10
Fungal PAQRs
If no accession number is given or only a partial protein sequence is found in the database then the protein sequence was derived from genomic sequence. Grey shading indicates genomes that are complete according to NCBI.
Dikarya; Ascomycota; Saccharomyceta; Saccharomycotina; Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces complex; "Post-WGD yeasts"; Saccharomyces cerevisiae
> Saccharomyces cerevisiae (Izh1p) NCBI:NP_010780

MSITTTRRRNQDSVCCKATRASIKVEAVSGQTVFEKQKLLHNFDELPEWQKDNDKILTGYVRETLSWKKCLYSLFYWNNETVNIYTHLVPAIVYFVFAITLTNYFLIPVFPSTSWSDYTVINIFLMGAFSCLMCSSCFHCMKQHSEKQSNFWSKLDYLGIISLISCSMIPIIYFGYFDHISYFSLFTIVTLVLATFCTVCVLHDKFNTSTFRPFRAMFFILFGFSGLLPLTTGFFKFGIQGVLNRIKVSFVFWEALFYISGAVIYGFRIPETLAPGKFDFFGSSHQIFHIMVVLGSVCHLKAIIDSYKLMHSHIHP*
> Saccharomyces cerevisiae (Izh2p) NCBI:NP_014641

MSTLLERTKSVQELKKRAAGKTSANPAEVAKAKKVLRRLYSWDEIPEWQRDNDFILHGYVKETSSFIETFKSLFYLHNESVNIYSHLIPALGFFTVLLLDKSTIKVFATTTWLDHMVIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILYYGYFEKFSLFCLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIIPIFSGLYCYSFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKICPGKFDIWGHSHQLFHFLVVIAALCHLRGLLNSYELVHIKMENGIVS*
> Saccharomyces cerevisiae (Izh3p) NCBI:NP_013123

MMDSSSKSLTQYIPSPMGSLSRLKQKGVDNFQKVKKSGKSIYNYNYSKFVPHPFSTIDESVKHSESGRYDDLEIIRPTKEKEVTSSVYKRNSGKSLNTESQFSLGDSDAATLVNSVATFKLNNASTSTSLVSSSSTVCSQAKSSLRSPTSRLNDTKIKEENNYISSVKDYCGPMRKSMVKTEILIEEPLNPTTDIKSFINSYNHGKAYSLGETQHLHYYQLPFPWRENRYIIHGYRFYNTHSKSLLSIFNWYGWHNETSNIWSHLLGAIYIIYLAIYDFPQSEVWRNSQVPPQARWIVFMFLAAALKCMLSSVFWHTFNGTSFLKLRSKFACVDYSGITILITASILTTEFVTMYSCYWAMYTYMSISLALGVFGVFMNWSPRFDRPEARPLRIRFFILLATMGVLSFLHLIFLTDLHYAATLFSPVTYKSVVWYLVGVVFYGSFIPERFRSDVQVDKTIPTNYELSTDLEIITKQREIHFREVPTAHSKCSSCPSHAKSFKSLWWVDYFGCSHTFWHFFVVLGVIGHYRAILDMFAKRWILS*


> Saccharomyces cerevisiae (Izh4p) NCBI:NP_014540

MVSLTTIEQSPVKCETTTEKESNDTRGTDSNENAETKETKKGFPFHDLAKLQKQYKNKSSRNESLVALIYLLGSMLSFCLLIFFTDFYLIPLFPTTTTMTDYIVFNFYLLNVFVFCMVHFIYHFVKNISLQQHLEHWQKFSYLSNINLLISSQITILYYLFYDYVFFFKIFTLLMNFIGLVAYFFILTDKLISSKRFNKTVFFISVSVVCCSLPLLTAIITFDGLENLKERIKVNAITWELVALVAASIIYVTRFPESLFRRNKKEEGWNHSEYLFHLLISGTAFYHFFILIQSYILMHSSLNQPELINFKS*
Dikarya; Ascomycota; Saccharomyceta; Saccharomycotina; Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces complex; "Post-WGD yeasts"; Saccharomyces bayanus
> Saccharomyces bayanus (Izh1p) NCBI Genome

MSITATRRRNQENVCCKTSTSIKVEALKSKVTLRKEKLLHDFHELPDWQRDNDKILTGYVRETLSWKKCLYSLFYWNNETVNIYTHLVPAIVYFVFGVTLTNYFLIPVFPSTTWSDYTVINIFLMGAFLCLMCSSCFHCMKQHSEKQSDFWSKLDYLGIISLISCSMIPIIYFGYFDHASYFSLFTIVTLVLATFCTICVLHDKFNTSTFRPFRAMFFILFGFSGLLPLTTGLFKFGLQGVLNRIRVSFVFWEALFYISGALIYGFRIPETLAPGKFDFFGSSHQIFHIMVVLGSVCHLKAIIDSYKLMHSHFHS*


> Saccharomyces bayanus (Izh2p) NCBI Genome

MSTLLERTNSVQELKKRAAGNTAANPAEVAKAKKVLKRVYSWDEIPEWQRDNDYILHGYVKETSSFVDTFKSLFYMHNESVNIYSHLIPAVGFLTVLLLDKTTITVFETTTWLDHMMIDLFFTGAFACLILSSSFHCFKSHSLKIATLGNKLDYLGICILIVTSMVSILYYGYYDKFPAFCLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYYYSFSEIWNQIQLFWVLLGGALYIIGAVLYGMRFPEKVYPGRFDIWGHSHQLFHFLVVIASLCHMRGVLNSYELVHIKMQNGIVS*


> Saccharomyces bayanus (Izh3p) NCBI Genome

MDSSSRNLTQYLPSPMESLSRLKRKGVDNFHKVKKSGKSIYNYNYSKFVPHPFSTIDETIKHSESDHDDHLESIDAPKRSKAESVIYKRTVGKSLRAESQLSLGDSDALTLVNSTSTFKLNSASTSTSLVSSSSTICSKTRTSSRSSTSFPNQPKIREERGHFSNVKEYCGPMKKSMRQTKILIEEPLNPTTDIKSYISSYNHSKAHSLGENQHLHYYQLPFPWRENRYIIHGYRFYNTHYKSLLSVINWYGWHNETSNIWTHLLGAMYIVYLAVYDFPHSEVWQNPEVPQQARWIVFAFLAAALKCMLSSVFWHTFNGTSFLGLRSKFACVDYSGITILITASILTTEFVTMYSCYWAMCTYMTISLALGVFGVFMNWSPRFDRPEARPLRIRFFILLATMGVLSFLHLIFLTDLHYAIWLFSPVTNKSVVWYLVGVVFYGSFIPERFRSDVQVDMTIPTDYELSTDLEIITKQKEIHFRKAPTTHSKCKACPSHAKSFKSLWWVDYVGCSHTFWHFFVVLGVIGHYKAILDMFTKRWAL*


> Saccharomyces bayanus (Izh4p) NCBI Genome

MASLTTVEQSPVEPKTATEKYSDATGAVTSNADVETKETKKGFPFHDLAKWQKQYKNKSSRSESLVALIYLLGSMSSFCLLIFFTDFYLIPLFPTTTTMTDYIVFNFYLLNVFVFCMIHFIYHFIKNISLQQHIEIWQKFSYLANINLLISSQITILYYLFYDYVFFFKIFTLLMTFIGLAAYFVILTDKLNSYKRFNKTVFFISVSVVCCSLPLLTAIITFDGLENLKDRIKLNAITWELVTLVVASMIYVTRFPESLCRRNEKEEGWNHSEYFFHLLISGTAFYHFFILIQSYILMHSSLNQPELINFKS*


Dikarya; Ascomycota; Saccharomyceta; Saccharomycotina; Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces complex; "Post-WGD yeasts"; Saccharomyces kudriavzevii
> Saccharomyces kudriavzevii (Izh1p) NCBI Genome

MSITTTRRRNQESVCCKATTASIKVEAVQSKTASEKEKLLHNFDELPEWQKDNDKILTGYVRETLSWKKCLRSLFYWNNETVNIYTHLVPAIIYFLFAITLTNYFLIQIFPSTSWSDYTVINIFLMGAFSCLMCSSCFHCLKQHSEEQSNFWSKLDYLGIISLISCSMIPIIYFGYFDHVSYFSLFTTVTLVLATFCTVCVLHEKFNTSTFRPFRAMFFILFGFSGLLPLTTGFFKFGIQGVLNRIKVSFVFWEALFYISGAVIYGFRIPETIAPGKFDFLGSSHQIFHIMVVLGSLCHLKAIIDSYKLMHSHIHP*


> Saccharomyces kudriavzevii (Izh2p) NCBI Genome

MSTLLERTKSVQELKKRAAGKTPANPAEVAEAKKVLKRLYSWDEIPEWQRDNDYILHGYVRETCSFVETFKSLFYMHNESVNIYSHLIPALGFFTVLLLDKSTIKVFETTTWKDHMIIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMTSILYYGYYEKFSLFCLFALITVSFGIACSIVTLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYCYTFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVVIASFCHLRGLLNSYELVHLKMEGKIVS*


> Saccharomyces kudriavzevii (Izh3p) NCBI Genome

MESSSRSLTQYIPSPMESLSRLKRKGVDNFQKVKKSGKSIYNYNYSKFVPHSFSAIDENIKHSENDNDDVLEIIGSRKEKKVSKAIYKRKGGQSPSEVSQLSLGDSDAVTLVNSVSNLKLNNASTSTSLVSSSSTVCSQTKISSRSSRSFSNQAKIKEENPYFSNVKDYCGPMKASMIKREILIEEPLNPTTDIKSFINSYNHSEAYSLGESQHLHYYQLPFPWRENRYIIHGYRFYNTHSKSLLSIINWYGWHNETSNIWSHLLGAMYIIYLAIYDFPQSEVWRNPNVPQQARWIVFMFLAAALKCMLSSVFWHTFNGTSFLRLRSKFACVDYSGITILITASILTTEFVTMYSCYWAMCTYMGISLALGVIGVFMNWSPRFDRPEARPLRIRFFILLATMGVLSFLHLIFLTDIYYASRLFGPVTYKSVVWYLVGVVFYGSFIPERFRSDVQVDKTIPTDYELSTDLEIITKQKEIHFRKVPTAHSKCNSCPSHVRSFKSLWWVDYVGCSHTFWHFFVVLGVIGHYKAILDMFARRWVLS*


> Saccharomyces kudriavzevii (Izh4p) NCBI Genome

MASLTTVEQSPAKCKTTTEKGNGTGETTNSNVDAETKEIKKGFPFHDLAKWQQQYRNKSSRNESLVALIYLLGSMSSFCLLIFFTDFYLIPLFPTTTTMTDYIVFNFYLLNVFVFCMVHFVYHFIKNISLQQHLEHWQKFSYLSNINLLISSQITILYYLFYDYVFFFKIFTLLMNFIGLVAYFFILTDKLNSSKRFNKTVFFISVSVVCCSLPLLTAIITFDGLENLKERIKVKAITCELVALVAASIIYVTRFPESLFRRNKKEESWNHSEYLFHLVISGTAFYHFFILIQSYILMHSSLNQPELINFKS*


Dikarya; Ascomycota; Saccharomyceta; Saccharomycotina; Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces complex; "Post-WGD yeasts"; Saccharomyces mikatae
> Saccharomyces mikatae (Izh1p) NCBI Genome

MSLTTTRRRNQESVCCSVTTGSIKVEAVSSTTVSEKKKLLHNFDELPEWQKDNDKILTGYVRETLSWKKCLYSLFYWNNETVNIYTHLVPAVIYFVFAITLTNYFLIPVFPSTSWSDYTVINIFLMGAFSCLMCSSCFHCMKQHSEKQSNFWSKLDYLGIISLISCSMIPIIYFGYFDHISYFSLFTIVTLVLATFCTVCVLHEKFNTSTFRPFRAMFFILFGFSGLLPLTTGFFKFGIQGVLNRIKVSFVFWEALFYISGAVIYGFRIPETLAPGKFDFLGSSHQIFHIMVVLGSICHLKAIIGSYKLMHSHIHP*


> Saccharomyces mikatae (Izh2p) NCBI Genome

MSTLLERTKSVQELKKRAAGKTSANPAEVAEAKKVLKRLYSWDEIPEWQRDNDFILHGYVRETSSFIETFKSLFYLHNESVNIYSHLVPALGFFTVLLLDKSTIKVFETTTWKDHVVIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILFYGYYEKFSLFCLFALITVSFGVACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYCYSFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVV IASLCHLRGL LNSYELVHIK MESGIIS*


> Saccharomyces mikatae (Izh3p) NCBI Genome

MMDSSSRSLTQYIPSPMGSLSRLKRKGVYNFQRVKKSGKSIYNYNYSKFVSHPFSVTDENIKHSENGHYDDLEIIGPAKEKNVASAIYKRNNSKSSNVESQFSLGDSDAVTLVNSVSTFKLNNASTSTSLVSSSSTVCSQSKPSSRSSRSYSVQTETNEENRCFSNVKDYCGPVKKSMIKTEIYIEEPLNPTTDIKSFINSYNHGKAHILGESKHLHYYQLPFPWRENRYIIHGYRFYNTHSKSLLSIFNWYGWHNETSNIWSHLLGAMYLIYLAIYDFPQSEVWKNPKVPPQARWIVFMFLAAALKCMLSSVFWHTFNGTSFLKLRSKFACVDYSGITILITASILTTEFVTMYSCYWAMCTYMGISLALGIFGVFMNWSPRFDRPEARPLRIRFFILLATMGVLSFLHLIFLTDLRYAARLFSPVTYKSVVWYLVGVAFYGSFIPERFRSDVQVDKTIPTNYELSTDLEIITKQREIHFRRAPTAHTKCKSCPSHAKSFKSLWWVDYVGCSHTFWHFFVVLGVIGHYRAILDMFAKRWVLS*


> Saccharomyces mikatae (Izh4p) NCBI Genome

MASLTTVEQSPAKCNTTPEKCNNSTAEINSTVGAKTKETKKGFPFHDLAKWQEQYKNKSSRNESVVALIYLLGSMLSFCLLIFFTDFYLIPLFPTTTTMTDYIVFNFYLLNVFVFCMVHFIYHFIKNISLQQHLEHWQKFSYLSNINLLISSQITILYYLFYDYVFFFKIFTLLMNFIGLVAYFFILTDKLISSKRFNKTVFFISVSVICCSLPLLTAIITFDGLENLKERIKVNAITWELVALVAASIIYVTRFPELFLRGKKKEEGWNHSEYLFHLIISGAAFYHFFILIQSYILMHSSLNQPELINFKS*


Dikarya; Ascomycota; Saccharomyceta; Saccharomycotina; Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces complex; "Post-WGD yeasts"; Saccharomyces paradoxus
> Saccharomyces paradoxus (Izh1p) NCBI Genome

MSITTTRRRNQDSVCCKATTASIKVEAVSDKTAFGKQKMLHNFDELPEWQKDNDKILTGYVRETLSWKKCLHSLFYWNNETVNIYTHLVPAIIYFVFAITLTNYFLIPVFPSTSWSDYTVINIFLMGAFSCLMCSSCFHCMKQHSEEQSNFWSKLDYLGIISLISCSMIPIIYFGYFDHISYFSLFTIVTLVLATFCTICVLHDKFNTSTFRPFRAMFFILFGFSGLLPLTTGFFKFGIQGVLNRIKVSFVFWEALFYISGAVIYGFRIPETLAPGKFDFFGSSHQIFHIMVVLGSVCHLKAIIDSYKLMHSHIHP*


> Saccharomyces paradoxus (Izh2p) NCBI Genome

MSTLLERTKSVQELKKRAAGNTSANPAEVTEAKKVLKRLYSWDEIPEWQRDNDFILHGYVKETSSFIETFKSLFYLHNESVNIYSHLIPALGFFTVLLLDKSTIKVFETTTWQDHMVIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILYYGYYEKFSLFCLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIIPIFSGLYCYSFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKICPGKFDIWGHSHQIFHFLVVIAAFCHLRGLLNSYELVHMKMENGIVS*


> Saccharomyces paradoxus (Izh3p) NCBI Genome

MMDPSSKSLTQYIPSPMGSLSRLKRKGVDNFQKVKKSSKSIYNYNYSKFVPHPFSAIDESIKHSENGLFDDLEIIDSPKEKKVTSSVYKRNSGKSLNAESQFSLGDSDAVTLVNSVSTFKLNNASTSTSLVSSSSTVCSQVKSSSRSSTNHSIQTRIKEENDYISSVKDYCGPVKKSMIKTEILIEEPLNPTTDIKSFINSYNHGKAYNLGETQHLHYYQLPFPWRENRYIIHGYRFYNTHSKSLLSIFNWYGWHNETSNIWSHLLGAMYIIYLAIFDFPQSEVWQNSQVPSQARWIVFMFLAAALKCMLSSVFWHTFNGTSFLNLRSKFACVDYSGITILITASILTTEFVTMYSCYWAMCTYMSISLALGVFGVFMNWSPRFDRPEARPLRIRFFILLATMGVLSFLHLIFLTDLRYAARLFSPVTYKSVVWYLVGVVFYGSFIPERFRSDVQVDKTIPTNYELSTDLEIITKQREIHFRKVPTAHSKCKSCPSHAKSFKSLWWVDYFGCSHTFWHFFVVLGVIGHYRAILDMFAKRWVLS*


> Saccharomyces paradoxus (Izh4p) NCBI Genome

MASLTTVEQGPAKCKATTGKDSNDTRETNPNVDAETKETKKGFPFHDLAKLQKQYKNKSSRNESLVALIYLLGSMLSFCLLIFFTDFYLIPLFPTTTTMTDYIVFNFYLLNVFVFCMVHFVYHFIKNISLQQHLEHWQKFSYLSNINLLISSQITILYYLFYDYVFFFKIFTLLMNFIGLVAYFFILTDKLISSKRFNKTVFFISVSVVCCSLPLLTAIITFDGLENLKERIKVDAITWELVALVSASIIYVTRFPESLFRRNKKEEGWNHSEYLFHLVISGTAFYHFFILIQSYILMHSSLNQPELINFKS*


Dikarya; Ascomycota; Saccharomyceta; Saccharomycotina; Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces complex; "Post-WGD yeasts"; Saccharomyces pastorianus
> Saccharomyces pastorianus (Izh1pA) NCBI Genome

MSITTTRRRNQDSVCCKATRASIKVEAVSGQTVFEKQKLLHNFDELPEWQKDNDKILTGYVRETLSWKKCLYSLFYWNNETVNIYTHLVPAIVYFVFAITLTNYFLIPVFPSTSWSDYTVINIFLMGAFSCLMCSSCFHCMKQHSEKQSNFWSKLDYLGIISLISCSMIPIIYFGYFDHISYFSLFTIVTLVLATFCTVCVLHDKFNTSTFRPFRAMFFILFGFSGLLPLTTGFFKFGIQGVLNRIKVSFVFWEALFYISGAVIYGFRIPETLAPGKFDFFGSSHQIFHIMVVLGSVCHLKAIIDSYKLMHSHIHP*


> Saccharomyces pastorianus (Izh1pB) NCBI Genome

MSITATRRRNQETVCCKTTTTSIKVEALNSKATLRKEKLLHDFHELPDWQRDNDKILTGYVRETLSWKKCLYSMFYWNNETVNIYTHLVPAIVYFVFGVTLTNYFLIPVFPSTTWSDYTVINIFLMGAFLCLMCSSCFHCMKQHSEKQSDFWSKLDYLGIISLISCSMIPIIYFGYFDHVSYFSLFTVVTLVLATFCTICVLHEKFNTSTFRPFRAMFFILFGFSGLLPLTTGLFKFGLQGVLNRIRVSFVFWEALFYISGALIYGFRIPETLAPGKFDFFGSSHQIFHIMVVLGSVCHLKVIIDSYKLMHSHFHS*


> Saccharomyces pastorianus (Izh2pA) NCBI Genome

MSTLLERTKSVQELKKRAAGNTSANPAEVAKAKKVLRRLYSWDEIPEWQRDNDFILHGYVKETSSFIETFKSLFYLHNESVNIYSHLIPALGFFTVLLLDKSTIKVFATTTWLDHMVIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILYYGYFEKFSLFCLFALITVSFGIGCSIVSLKDKFRKREWRPYRAGLFVCFGLSSIIPIFSGLYCYSFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKICPGKFDIWGHSHQLFHFLVVIAALCHLRGLLNSYELVHIKMENGIVS*


> Saccharomyces pastorianus (Izh2pB) NCBI Genome

MSTLLERTNSVQELKKRAAGNTSANPAEVAEAKKVLKRVYSWDEIPEWQRDNDFILHGYVKETSSFVDTFKSLFYMHNESVNIYSHLIPAVGFLTVLLLDKTTITVFETTTWLDHMMIDLFFSGAFACLILSSSFHCFKSHSLRIATLGNKLDYLGICILIVTSMVSILYYGYYDKFPVFCLFALITLSFGVACSVVSLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYYYSFSEIWNQIQLFWVLLGGGLYIIGAVLYGMRFPEKVYPGRFDIWGHSHQLFHFLVVIAALCHMRGVLNSYELVHIKMQNGIVS*


> Saccharomyces pastorianus (Izh3pB) NCBI Genome

MDSSSRNLTQYLPSPMESLSRLKRKGVDNFHKVKKSGKSIYNYNYSKFVPHPFSTIDETIKHSESDHDDHLETIETLKGKKVESSIYKRTVGKSLRAESQLSLGDPDALTLVNSTSTFKLNSASTSTSLVSSSSTICSKTRTSSRSLTSFSNQLKIREECGHFSNVKEYCGPMKKSMRQTKILIEEPLNPTTDIKSYISSYNHSKAHNLGENQHLHYYQLPFPWRENRYIIHGYRFYNTHSKSLLSIINWYGWHNETSNIWTHLLGAMYIVYLAVYDFPQSEVWQNPKVPQQARWIVFAFLAAALKCMLSSVFWHTFNGTSFLGLRSKFACVDYSGITILITASILTTEFVTMYSCYWAMCIYMSISLALGVFGVFMNWSPRFDRPEARPLRIRFFILLATMGVLSFLHLIFLTDLHYAIWLFSPVTNKSVVWYLVGVVFYGSFIPERFRSDVQVDMTIPTDYELSTDLEIITKQKEIHFRKAPTTHSKCKSCPSHAKSFKSLWWVDYVGCSHTFWHFFVVLGVIGHYRAILDMFTKRWALS*


> Saccharomyces pastorianus (Izh3pA) NCBI Genome

FQKVKKSGKSIYNYNYSKFVPHLFSTIDESVKHSESGRYDDLEIIRPTKEKEGTSSVYKRNNGKSLNTESQFSLGDSDAATLVNSVATFKLNNASTSTSLVSSSSTVCSQAKSSLRSPTSRLNDTKIKEENNYISSVKDYCGPMRKSMVKTEILIEEPLNPTTDIKSFINSYNHGKAYSLGETQHLHYYQLPFPWRENRYIIHGYRFYNTHSKSLLSIFNWYGWHNETSNIWSHLLGAIYIIYLAIYDFPQSEVWRNSQVPPQARWIVFMFLAAALKCMLSSVFWHTFNGTSFLKLRSKFACVDYSGITILITASILTTEFVTMYSCYWAMCTYMGISLALGVFGVFMNWSPRFDRPEARPLRIRFFILLATMGVLSFLHLIFLTDLHYAATLFSPVTYKSVVWYLVGVVFYGSFIPERFRSDVQVDKTIPTNYELSTDLEIITKQREIHFREVPTAHSKCSSCPSHAKSFKSLWWVDYFGCSHTFWHFFVVLGVIGHYRAILDMFAKRWILS*


> Saccharomyces pastorianus (Izh4pA) NCBI Genome

MVSLTTIEQSPVKCETTTEKESNDTRGTDSNENAETKETKKGFPFHDLAKLQKQYKNKSSRNESLVALIYLLGSMLSFCLLIFFTDFYLIPLFPTTTTMTDYIVFNFYLLNVFVFCMVHFIYHFVKNISLQQHLEHWQKFSYLSNINLLISSQITILYYLFYDYVFFFKIFTLLMNFIGLVAYFFILTDKLISSKRFNKTVFFISVSVVCCSLPLLTAIITFDGLENLKERIKVNAITWELVTLVVASMIYVTRFPESLFRRNEKGEGWNHSEYLFHLLISGTAFYHFFILIQSYILMHSSLNQPELINFKS*


> Saccharomyces pastorianus (Izh4pB) NCBI Genome

MASLTTVERSPVKTATEKYSDATGEVTSNTDAETKETKKGFAFQDLAKWQKQYKNKSSRSESLVALIYLLGSMSSFCLLIFFTDFYLIPLFPTTTTMTDYIIFNFYLLNVFVFCMIHFIYHFIKNISLQQHLEHWQKFSYLANINLLISSQITILYYLFYDYVFFFKIFTLLMTFIGLAAYFVILTDKLNSYKRFNKTVFFISVSVVCCSLPLLTAIITFDGLENLKDRIKLNAITWELVTLVVASMIYVTRFPESLFRRNEKGEGWNHSEYLFHLLISGTAFYHFFILIQSYILMHSSLNQPELINFKS*


Dikarya; Ascomycota; Saccharomyceta; Saccharomycotina; Saccharomycetes; Saccharomycetales; Saccharomycetaceas; Saccharomyces complex; "Post-WGD yeasts"; Naumovozyma; Naumovozyma castellii (aka Saccharomyces castellii)
> Naumovozyma castellii (Izh1p) NCBI Genome

MSRVTTTRRKPTKVQAVAVGSSNKHADGDKTKRNWKRRLFNFNELPEWQRDNDKILTGYVRETKSFKQCLQSLLYWNNETINIYTHLIPALFYLTISVTLINYVVVPHFPTTSIMDYFVINVFLMGAFVCLILSSCFHCLKQHSSRQCTLWSKLDYMGIIILISCSLIPMIYFGYFDHLYYVNFFIILTFSFATLCSICVLNEKFNVPHYRPFRAIVFMLFSFSGFIPILTGFYLFGFHGVFERVALKFVAWEALFYITGATLYGFRIPECFKPGDFDFLGSSHQIFHILVVLGSICHFRAVIKSYILMHSSMN*


> Naumovozyma castellii (Izh2p) NCBI Genome

MTKNLQQRVALTSTSTSTKTTIDDDNVSIKHTKKTTTIRKLYTWDEIPEWQKDNEHIIAGYVRETNSFRRCFDSLFYIHNETGNVYSHLVPGVVFFLTMLFDKYAIVSFETTTFTDYLIINLFFLGAFTCLILSSTFHCFKSHSLKIATFGNKLDYLGIVVLIVTSMISILFYGFYDNGPFFYGFSLLTLSFGSACAIVSLKDKFRSREWRPYRAGLFVAFGLSAVLPILTGVMYYGPHETWTRIQLKWVVLEGVFYIFGAFLYGIRFPEKYVNGTFDIWGHSHQIFHLLVVVAAFCHLKALLGSYELVHMNL*


> Naumovozyma castellii (Izh3p) NCBI Genome

MTVQGSRADCAYSTKMVTNVLPTALDSLSRLKKKGMSNVNRVRKSGRDLASRYGYSRFMANPFAATEHDKEIVYDPTIPENENLKLLSKMESSNDFIPNMEHHKLISRSNSANDLGSQVSLNSEAQTLVNAFSSTNSSLFKTSRQGSSPYSNPIAASSTSLFSAPTRVSSTVFNEEFKLDVVTEYQPLTKPSEEVKNLICSYNHEVAYEIGKTEHLNYYQLPFPWRENRYIIYNYRFYDSHKKSLLSIFNWYGWHNETSNIWTHLIGGLYLIYMAVYDFPRSEIFLSDKIPTTAKLIVYLFLFAAIKCLFASVFWHSFNGTCTLKLRSKFACVDYSGISILITASILTTEFVTLYSSYRAMCVYMAISLSLGIFGVFMNWSPKFDRPEARPLRIKFFVLLASMGVLSFLHLTFLTDWKYATWLLAPVTNKSIVWYCIGVVFYGSFIPERFRSDVQVDPTIPTTFQLSTDLNIITKDKNIHFRSEPVVNEEVHNCKEHWKSFKSLWWVDYVGCSHTFWHFFVVLGIIGHYRAIIDMFTKRWLLA*


> Naumovozyma castellii (Izh4p) NCBI Genome

MATLTSTTKKQTATEIQDADKLTPFNAPKYSVTFPRRPKVLPILKELPQWQKQYSNSKIINGYVRETNSLIKCLHTVTYWNNQTVNIILNTVFSTVYFTLLLFFTDLYLIPSSPATTMSDYIMVNFYLFGAFQYLALNSIFYLLESHSLAKCHLWFKLSHLAFINYISTSIITQLYYTFFDNVFYFKFLTISTLLISSIFAIFTLSEQFLRKNRSQRNMVSITFIVSLLILPTASLMFKFNTFRILRRVEGKAILLELSLYLFSMTLKAVQVPERFSENFDFIGNSENIYHICIILGSLLHFKMLLNSYFFMHSGLDASNLVTFNV*


Dikarya; Ascomycota; Saccharomyceta; Saccharomycotina; Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces complex; "Post-WGD yeasts"; Nakaseomyces; mitosporic Nakaseomyces; Candida glabrata
> Candida glabrata (Izh1p) NCBI:XP_446561

MSATTTLRKRASKSVGESGGRNDGSIHAHGEEKSEKLLWHFNELPEWQKDNDKILRGYVRETNSFKRCLQSLLYLNNESVNIYTHLIPAVFYISLSLYLANVFLIPVYPSTSSVDYVIINVFFLGAFFCLLCSSCFHCMKQHSESQCNVWSKLDYLGIICLISCSTVPMIYYGYFDHISEFTIFTGITLLLAIGCSVFVLTDKFNTTEYRPIRASFFTLFGFSGIIPLGAGFLKFGAEGVLQRISLPFIGLEALFYISGAIIYGFRFPETIAPGKFDFFGSSHQIFHIMVVLGSICHLFAMVESYHLIHSNFLRPV*
> Candida glabrata (Izh2p) NCBI:XP_445799

MGDVHQRKVATMVTTEEQPLIGTDGQIKLRKKTVVRKLYTWEEIPEWQKDNEHIHTGYVRETSSVMECIRSLFYLHNETVNIYSHLIPAIAFFSTIFFNKYVVPTYSTTTLIDYLIIDIFFLGAFSCLILSSTFHCLKSHSLRVAVFGNKLDYLGIVFLIVASMVSILYYGFHGNPWFFGIFSLITMTFGAACAVVSLKDTFRSREWRPYRAALFVIFGLSAVLPILAGLFKYGPTETWTRIQLKWVILEGVFYIFGAFLYGIRFPEKMSPGSFDLWGHSHQIFHILVVVAALCHLKALLGSYSLVHYRFMIDMY*
> Candida glabrata (Izh3p) NCBI:XP_445561

MDSISSASKHVSQYFDFEPSLHKWKQRGLDNIHRVRQTGRNVRYPRFIHNTWNSLTSYTDELRAPDNDAKARSQGQNKVTRPARSRAPKKNRYSESTISLTSDANTLVNSNASTTSFSRFRAPKPATTSNSFGSVGSGGSSPNDYSSTTSLSSAATPVPEELLEYVEKPVYTLTFKDDDVVVKEEEIIEELDIKTYINTYNYENAFEFGKVRHLHYYELPFPWRENRCIINGYRFYNSHKKSLLSIVNWYGWHNETSNIWTHLLGGLYILYLMFYQFPSSEVFMSEQVPKAAKLITYVFLIAAAKCLFSSVFWHTFNGTSLLRLRCKFACVDYSGISILITASILTTEFVTMYQCPWAMVSYMALSTALGIFGVFMNWSPKFDRPEARPLRIKFFILLASMGILSFLHLTFITSLSHSTWLLSPITKKSVVWYLVGVVFYGSFIPERWRTDIQYDHTIPTSHELSTNVDIINKEKHIHFRETPTPHEMCKHHEHHHRSFKSLWWVDYVGCSHTLWHFFVVLGVIGHYRAILDILTKKWILSGSPL*
> Candida glabrata (Izh4p) NCBI:XP_447574

MEKKTVQSKIVTLEKLPVWYRRYGNSRIKTGYFYYTNATYLGCLQKLVKFNNDSISIYMNLVCGLISGVMLLFYTDVRLIPSHPSTTMTDYIIINLFLMATTTYFATMTLGQLLKGHSEYQGKLWNQAKQLALVLLLTCSIVTLLYYAFFDHVFLFKLFVIWTCLLMSITSIVIINDQYKRVQKLSCVVIFGVLSISLPIAVSIIKFGLFDSYKKQRIPFQVLTWEIVLYSLSAMLQLTRLPELTLSTLGDSFWIVDYLGNSDQVSQLVTIFAIIVHFNTIIFAYEVVHASIHVPPMISFK*
Dikarya; Ascomycota; Saccharomyceta; Saccharomycotina; Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces complex; "Post-WGD yeasts"; Vanderwaltozyma; Vanderwaltozyma polyspora (aka Kluyveromyces polysporus)
> Vanderwaltozyma polyspora (Izh1p) NCBI:XP_001644147

MAHIATVEREYSSVSKRRTSKSANGTVTIEVEREEHEEIKLCHFHELPDWQKDNEFILTGYVRETNSIKKCLRSLGCFNNESINIYSHLIAAISYFVVLLFYTDILCIPSFPSTTFVDYMVIDLYLLGAFTCLIGSSLFHCMKQHSESHSDMWSKVDYIGIICLITCSLISLLYYGYMDHFIYFKVFTVITLVLATICTICVLDQRFNSKNFRPIRAGFFILFSMSAVIPIGAGFSKFGFTEVLQRIQLRFVAWETFFYVVGALLYGFRIPETLYPGNFDLVGSSHQIFHIMVILGSVFHLKAVLGSYTFMHSNISSNSFTLSS*
> Vanderwaltozyma polyspora (Izh2p) NCBI:XP_001646275

MVSQNIRRRSITSTSSTVTTVQVEKDGAKSSYSYIKRGVQLVTWEHLPDWQKDNEHILSGYVKETNSIKACLHSLLFIHNESVNIFSHLVPAFCFMTTIIFDKYVVERYPTTTLKDYLMLDLFLFGAFTCLMMSSAFHCLKAHSPYVSSFGNKLDYLGIVVLIVSSMSSILYYGFYDNSFLYFTFSAITFTFGLSCAVVSLGERFRAREWRPYRAAMFVAFGLSALLPIFAGFLYYGVQETTIRVQLKWVVLEGVFYIFGALLYGVRFPERLKPGMFDIWGHSHQLFHILVVVAALCHLRGLLGSYTIVHTRLSSLTQ*
> Vanderwaltozyma polyspora (Izh3p) NCBI:XP_001646881

MESSTACSSMLTSENDEGSLNSSYSKKMADAVISSTSYSLDSISRLKRKSIDLVKKKSNEYISIGSGGSTVTNETFANLDNDGSNGSSTTISASLMNRLNRVKEKHLWRSNIKNSADTNKGTGAKNGNVKGIKVVDDEMLLLSRLSQDTLNNDSTFPLKTIAKLDSDVYSQFSDSNITLTNSVINTDMDKNINSLDNTPREPASKNSIHELLDEEHMWISEAMAENDNDLTYVIKSYNHSIAYDLGQDKHLHYYQLPFPWRENRYIINGYRFYHKNSKLLLSVFNWYGFHNETANIWSHLLGAIYFAYIVLFEFPKSFIVQSPEVPPSAKYIVYLFLLAGIKCMLASVFWHTFNGTCSIKLRPKYCCVDYSGITILITASILTAEFVSLYDHRSIMTVYMSLSLLFGCFGLYLNWSPKFDSPEARPLRIKFFILLAALGGLAFFHVAYLEGMAYAAWLYSPVTSKSIVWYLIGVFFYGSFIPERFRSDFVIDKSIPNSKQLASDVTIITKHKHVHFREEPTKTNHCKDCTSKSFKTLWWVDYICNSHNIWHVFVFLGVMGHYNAILDMFAKKWLTNI*
Dikarya; Ascomycota; Saccharomyceta; Saccharomycotina; Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces complex; Pre-WGD yeasts; Zygosaccharomyces; Zygosaccharomyces rouxii
> Zygosaccharomyces rouxii (Izh1p) NCBI:XP_002495237

MSSITEVKRRRVPIGNGNGEGLYKEVLEEKTLYDFHELPEWQQDNDKILTGYIRETKSVLKCVRSLFIWNNETVNIYTHLVSAVSYFLLMLGITDLVMVPHFPTSTFTDYSVINFYLLGAFGCLMCSSCFHTFKQHSGPHSDAWSKVDYMGIIVLITCSMISLIYYGFFDHMEYFRLFTVLTLTLATACTVCVLSDKFNHKDFRPLRAGFFIAFGLSGVFPVAAGIIKFGIQGGVQRVQLKYLGLEAIFYIAGALIYGFRIPETMFPGRFDFWGHSHQIFHVLVVIASFLHLKAVMGSYIFKHSHLNGVGLAALQSTY*
> Zygosaccharomyces rouxii (Izh2p) NCBI:XP_002495978

MSNLKKRSSLSTTTSDSQTNLEVNQEQTTIKIEPVNTQKKLLYTWNEIPDWQKDNEHIVGGYVRETNSIRECLQSLLYLHNESINIYTHFLPGLCFLATCIFDKFAIKNFDTTTWIDYMAIDFFFFGAFSCLILSSTFHCFKSHSSRVSVFGNKLDYLGIVILIVCSMISILYYAFHDSNKLFYSFTLIIFCFGVSCTIASFDDTFRSREWRPYRAGLFVAFGLSALLPIMGGIIKYGFHETWTRIQMKWVILEGIFYIFGAFLYSIRFPERLAPGAFDFVGHSHQIFHVLVVIAALCHLVALMNSYELVHTNLLSNST*
> Zygosaccharomyces rouxii (Izh3p) NCBI:XP_002495407

MQSEAPLSSLRPINFNTIHKLRRRVKIGSVSVFNNKYCNAISNAIGRGHNGKDKNKDDEKEDEKNEAEAEGEDKDEEEDDFYDQDERKPFARSSTPEYLLSQKVKNTYKNGRLRDSKSITPNDSNISLLSEANTLVGSSTVVNENNSDENNGGRLSWSLNSSSSSPTVHSSSITSGGELCSTDVKTYIRNFNHSAAYQLGHKCHLHYYQLPFPYRENKYIIHGYRFYASHKKSFLSIINWYGWHNETSNIWTHLLGGLYLIYLAFYHFPHSNIWLSDRVPKPAKCIVAVFLAAAIKCMFASVFWHTFNGTHLLRLRSKFACVDYTGITILITASILTVEFVTMYDYKISLLFYMICSLALGIIGVSMNWSPKFDRPEARPLRIKFFILLATVGCSSFIRLVFLTNWRYAADLLTPLTNKSVVWYLIGVFFYGSFIPERFRTDILTDKSIPTEKQLSTDLDIVTKHRDIHFREKPTIHPRSQCCQHHAGSFKSLWWVDYVGCSHTLWHFFVLLGVIGHYNAIMDMFTKRWIL*
Dikarya; Ascomycota; Saccharomyceta; Saccharomycotina; Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces complex; Pre-WGD yeasts; Lachancea; Lanchancea kluyveri (formerly Saccharomyces kluyveri)
> Lachancea kluyveri (Izh1p) NCBI Genome

MSSTTTVRQRRKTTQKASAESIATAKGRKRLCTFEELPDWQKDNELILDGYVRETRSVSECFKSLLYFHNETVNIYTHLVPGVTYLLMLMFLTDFILIPKFPSSTMTDYIIINFFLLGAFVCLMCSSCFHCLKQHSEEHSDIWSKVDYMGIIVLISCSMVSILYYGFHDHLFHFKIFTVVTVILGSCCAAFVLNDRFNSKNFRVFRASFFVSFGFSGLVPIIFGLVKFGISESVHRVQLKYVGLEAVFYIGGAVFYGFRIPENFGPGKFDLVGHSHQIFHVMVVLGSLCHLRAVVGSYIFMHTGVNYPGFLVFK*


> Lachancea kluyveri (Izh2p) NCBI Genome

MSTGTINKKRVRRLYSWEEIPDWQKDNEHIRHGYVRETNSFLGCFDSLFYMHNESVNIYTHLLPGLCFFFVVLFDKVAIKVFDTTTFLDYIMVDLFFLGAFTCLILSSTFHCLKTHSLRIAILGNKLDYLGIVALIVSSMISIMYYGFFDSGKFFYGFSTLTLVFGIACAIASLSDTFRSREWRPYRAALFVAFGLSAVLPIFSGVAVYGFKETWVKVQVKWVLLGGVFYIIGALLYALRLPERISPGKFDIWGHSHQIFHILVVIAALCHLKAVLNSYELVHKKLASI*


> Lachancea kluyveri (Izh3p) NCBI Genome

MERKEKDLEAVALNRLDKFINSLDHKLEKLEAMLPSSTSASGLPTPNLNRLKQRGKKFVRWGMNQVRDAPPPVQPEKQGAPHQQEEEVTTLYKFLKSTTEEFNGKETTPLESDTATLVGSNSSISLIRFSKIWHDHFNSGGNSNNGTVVHNSSSASFHSSSSTLITTSPERPNSPPSSRKSSSSVATEDVLQSLDYLDEKLETLIQDPGSIGQTIQLFNYDVAFKTGLSRHLHYYELPFPWRENRFIIHGYRFYHSHTKSLLSILNWYGWHNETTNIWTHLFGSLYIAYLAFYEFPQSSVYLSGDVPQFAKYMVYLFLGAGFKCLVSSVTWHTFNGTCKLHLRSKFACMDYTGITVLITASIMTAEFVSLYGNGDNPNSPVTFSLIFYMAVSSVLCCFGVFMNWSPRFDRPESRPLRIAFYLLLAGMGFLAFLHLTLITNFAHSSWLIRPVLDKSVCWYLIGVIFYGSFIPERWRSDILVDKCIPTHEELSKNLEIITTHKHIHFRENPTKHNHSVHKKSFRSLWWVDYYCCSHTLWHLFVLLGVVGHYRAVLDMFEKKWLSS*


Dikarya; Ascomycota; Saccharomyceta; Saccharomycotina; Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces complex; Pre-WGD yeasts; Lachancea; Lanchancea thermotolerans (formerly Kluyveromyces thermotolerans)
> Lachancea thermotolerans (Izh1p) NCBI:XP_002552634

MSSTYTLRQRRQQCAPNKGKAGTSGATAPGKNGLCCFEELPDWQRDNDKILAGYVRETNSMKKCFESLTYFHNETVNIYTHLIPSGTYLVMLMFFTDLFLIPQFPTTTMSDYIMINFFLLGAFLCLMCSTCFHCLKQHSEAQSNIWSKVDYMGIIVLISCSTVSLLYYGFYDYLFHFKMFTIAVVVLGSCCAAFVLNDRFNAKNWRACRAGFFVTFGFSGIVPIVVGLVKFGIAESSKRVQLRFVLLEALFYISGAVIYGFRIPETLLPGKFDFVGHSHQIFHILVVLGSLCHFRALLGSYFFMHTGISSPGLLNLKAL*
> Lachancea thermotolerans (Izh2p) NCBI:XP_002552697

MEQGGLTQRKPVEVELHHRMVEENSSLLKDSNLKQRTKRRLYTWDEIPEWQRDNEHIVGGYILETKSTWECLKSLLYLHNESVNIYTHLLPGWCFLLVAVFNQVVIEKFETTRLIDYVMIDLFFLGGFTCLMMSSVFHCFKCHSLPVAILGNKLDYLGIVALVVTSIVSILFYGFHDYDLYFWLFSGLTMAFGLACATVSLSNKFRSREWRPYRASLFVAFGLSALLPVIAGALHYGLKETWTRIQLEWVLLGGVFYILGAVLYGIRFPERMAPGCFDIWGHSHQLFHILVVVAALCHLRALLGAYKLFHHVKVV*
> Lachancea thermotolerans (Izh3p) NCBI:XP_002551941

MDRLESLLPNDGAYRPRLHKLRTRGKQIVRWSKSQVAGVPAYALRKITWGAASEADEDAGDDARAAAAEPPTELFAADFDAITMVDSRPQSMLNSYRMKDAQTARWHAKTATAAAAMASGVSYVSSAATLVSSSSFSSAENISLSLPSASPARSLSSADSCGTSPVSPVAGLRICDAKAIEKSFQSIQNDAEAVAASIKFHNYEVALQLGQQRHLHYYELPFPWRENRFIIHGYRFYNSYSKSLLSIFNWYGWHNETVNIWTHLCGALYFAFLIFKGFSQTTVYQSELVPTAAKFMAFVFLTAGLECFLFSVVWHTFNGICHLKQRSNCACVDYTGITVLVTASILTTEFVTLSGSSDATFTWSLLFFTGASAALGAVGVFMNWSPKFDRPESRPLRIAFYLLLASFGFFSYLHSRLFNTAVDSSDLIKPVFMKSLAWYIIGVVFYGTFIPERWRSDVQVDANIPTEEQLTTDLEIITKHRHIHFRSQPASHHKCKNADHKRSFKSLWWVDYFCCSHTLWHLFVLLGVIGHYTAMLEMFEKRWLRG*
Dikarya; Ascomycota; Saccharomyceta; Saccharomycotina; Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces complex; Pre-WGD yeasts; Lachancea; Lanchancea waltii (aka Kluyveromyces waltii)
  1   2   3   4   5   6   7   8   9   10


Verilənlər bazası müəlliflik hüququ ilə müdafiə olunur ©azrefs.org 2016
rəhbərliyinə müraciət

    Ana səhifə